Gene Information

Name : Rumal_2054 (Rumal_2054)
Accession : YP_004105179.1
Strain : Ruminococcus albus 7
Genome accession: NC_014833
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 2313982 - 2314314 bp
Length : 333 bp
Strand : -
Note : PFAM: IS66 Orf2 family protein; KEGG: ere:EUBREC_3236 transposase

DNA sequence :
ATGCTGAATGATCTGGCAGCGGACGCACAGGTCTATCTTGTTACGGGATACACCGACCTTCGACGCGGGATAGACGGACT
TGCGACTATCGTTCAGGCTCAGCTTCGACTTGACCCGTTCTCGAAAGCATTGTTTTTGTTCTGCGGCAGACGTTGTGACC
GCATCAAAGGTCTGCTGTGGGAGGGCGATGGTTTTCTGCTGTTGTACAAGCGCCTTGACAACGGAAGATTCCAGTGGCCG
CGCAGTGAGACCGAAGCAGTAATGCTCACATCTCAGCAAATTCGCTGGCTTCTGGAAGGCTTAGAAAATAGAGCAGCCGA
AGGCTATCCGTGA

Protein sequence :
MLNDLAADAQVYLVTGYTDLRRGIDGLATIVQAQLRLDPFSKALFLFCGRRCDRIKGLLWEGDGFLLLYKRLDNGRFQWP
RSETEAVMLTSQQIRWLLEGLENRAAEGYP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 5e-16 49
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-16 49
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-15 48
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 7e-13 46
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-14 44
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-15 44
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-15 44
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-15 44
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-15 44
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-15 44
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-15 44
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-15 44
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-15 44
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-15 44
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-15 44
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-14 44
unnamed AAL08461.1 unknown Not tested SRL Protein 6e-15 43
unnamed AAF71493.1 unknown Not tested Hrp PAI Protein 4e-14 43
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 5e-16 42
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-12 41
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rumal_2054 YP_004105179.1 IS66 Orf2 family protein VFG1665 Protein 6e-16 48
Rumal_2054 YP_004105179.1 IS66 Orf2 family protein VFG1517 Protein 3e-13 46
Rumal_2054 YP_004105179.1 IS66 Orf2 family protein VFG0792 Protein 1e-15 44
Rumal_2054 YP_004105179.1 IS66 Orf2 family protein VFG1698 Protein 7e-16 44
Rumal_2054 YP_004105179.1 IS66 Orf2 family protein VFG1709 Protein 1e-15 44
Rumal_2054 YP_004105179.1 IS66 Orf2 family protein VFG1052 Protein 2e-15 43