Gene Information

Name : Rumal_2365 (Rumal_2365)
Accession : YP_004105479.1
Strain : Ruminococcus albus 7
Genome accession: NC_014833
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2653029 - 2653610 bp
Length : 582 bp
Strand : -
Note : PFAM: stress protein; KEGG: cdl:CDR20291_1532 tellurium resistance protein

DNA sequence :
ATGCCTATCAATCTTAGCAAAGGACAGAAAGTAAGCTTAACAAAGGGTAATCCCGGACTGAAGAATATCATGGTAGGTCT
GGGCTGGGACGTAAACGCATTCGATTCAGGTTCTGATTTCGACCTGGATACAGCTGCATTCATGGTAGATGACAGCGGCA
GATGCCCCACCGAGAAGGAATTCATCTTCTACGGCAACCTTGAGCACGCAAGCGGTTCTGTTAAGCACATGGGTGATAAC
CTGACAGGCGGCGGCGACGGCGATGACGAGCAGATCATGATCGACCTGAGCCTGATCCCTGAAAATATCTCCAAGATAGC
TTTCACTGTTACTATATATGATGCTGACAACAGAAGACAGAACTTCGGTCAGGTATCCAATTCCTTCATCCGTGTTGTAG
ATCAGGCAACCGGTGAGGAGATCATCAGATATGATCTGGGTGAGGATTTCTCCATCGAAACTGCGATCGTTGTAGGCGAG
CTTTACAGAAATAACGGCGAGTGGAAGTTCAACGCTATCGGCAGCGGCTTCCAGGGCGGTCTGGCTGCACTTTGCGGTCA
CTACGGCATCGACGCTGAGTAA

Protein sequence :
MPINLSKGQKVSLTKGNPGLKNIMVGLGWDVNAFDSGSDFDLDTAAFMVDDSGRCPTEKEFIFYGNLEHASGSVKHMGDN
LTGGGDGDDEQIMIDLSLIPENISKIAFTVTIYDADNRRQNFGQVSNSFIRVVDQATGEEIIRYDLGEDFSIETAIVVGE
LYRNNGEWKFNAIGSGFQGGLAALCGHYGIDAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-50 56
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-50 56
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-50 56
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-50 55
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-45 53
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-45 53
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-45 53
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-43 50
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-21 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-21 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rumal_2365 YP_004105479.1 stress protein BAC0389 Protein 3e-50 56
Rumal_2365 YP_004105479.1 stress protein BAC0390 Protein 3e-47 53
Rumal_2365 YP_004105479.1 stress protein BAC0392 Protein 3e-22 42