Gene Information

Name : Selin_0006 (Selin_0006)
Accession : YP_004111321.1
Strain : Desulfurispirillum indicum S5
Genome accession: NC_014836
Putative virulence/resistance : Resistance
Product : Cd(II)/Pb(II)-responsive transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 5954 - 6361 bp
Length : 408 bp
Strand : -
Note : TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional regulator; PFAM: Transcription regulator MerR DNA binding; regulatory protein MerR; KEGG: aby:ABAYE3654 MerR family transcriptional regulator; SMART: regulatory protein MerR

DNA sequence :
ATGCGCATTGGTCAGTTGGCGCAGTTGGTAGGGGTCGAAACACAGACGATCCGCTTCTACGAACGGCAGGGCTTGTTGCC
GCCGCCTGGTCGGCAGGAGAACGGTTACCGTGTCTATACCGAGAAACACGTTGAGCGGCTGGCCTTTATTCGTCGCTGCC
GCATCCTGGATCTGTCACTGGCAGAAATTCACGAACTAAAGCGCTATCAGGACGACCCTCATCAGTCCTGTACCGCTGTC
AATGCCTTGCTCGATGATCACATCTCTCATGTGCGCTCGCAGATAACCGCTCTACAGGCGCTTGAGAAACAACTCGTTTC
ACTAAGAGCGCGTTGCAACGATGACCGGGAAGTTAAGGCGTGTGGGGTTCTTGCTGGAATTAGCGAGGGAAGCATGCACC
AGCAGTAG

Protein sequence :
MRIGQLAQLVGVETQTIRFYERQGLLPPPGRQENGYRVYTEKHVERLAFIRRCRILDLSLAEIHELKRYQDDPHQSCTAV
NALLDDHISHVRSQITALQALEKQLVSLRARCNDDREVKACGVLAGISEGSMHQQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 3e-59 99
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 4e-59 99
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 3e-59 99
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 2e-58 98
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 9e-59 98
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 1e-58 98
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 9e-59 98
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 4e-31 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Selin_0006 YP_004111321.1 Cd(II)/Pb(II)-responsive transcriptional regulator BAC0301 Protein 3e-27 50
Selin_0006 YP_004111321.1 Cd(II)/Pb(II)-responsive transcriptional regulator BAC0058 Protein 6e-32 49