Gene Information

Name : Alide_1829 (Alide_1829)
Accession : YP_004126464.1
Strain : Alicycliphilus denitrificans BC
Genome accession: NC_014910
Putative virulence/resistance : Resistance
Product : hg(ii)-responsive transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1888582 - 1888989 bp
Length : 408 bp
Strand : +
Note : TIGRFAM: Hg(II)-responsive transcriptional regulator; PFAM: Transcription regulator MerR DNA binding; regulatory protein MerR; KEGG: ajs:Ajs_1301 MerR family transcriptional regulator; SMART: regulatory protein MerR

DNA sequence :
ATGGAGAACGCTTCGGAGAATCTGACCATCGGCGCCTTCGCCAAGGCGGCCGGTGTCAACGTGGAGACGATCCGCTTCTA
TCAGCTCAAGGGCTTGCTGCCCCAGCCGAAGCGGCCGTACGGGAGCATCCGCCGCTACGGGCAGGCGGATGTGGCGCGGG
TGAAGTTCGTGAAATCAGCTCAGCGCCTGGGGTTCAGCCTGGATGAAGTTGGTCAGCTCCTGAAACTGGAGGACGGCACT
CATTGCAGCGAGGCGGCCGAGCTAGCCGTCCATCGGCTGGCCGATGTGCGCGCACGCATGGCGGACCTCACGCGGATGGA
AGACGCGTTGTCGAAGCTGGTGAGCGAGTGCGACGCGCACCATGGCAATGTTTCCTGCCCGTTGATCGCAGCCTTGCATT
GTTGCTGA

Protein sequence :
MENASENLTIGAFAKAAGVNVETIRFYQLKGLLPQPKRPYGSIRRYGQADVARVKFVKSAQRLGFSLDEVGQLLKLEDGT
HCSEAAELAVHRLADVRARMADLTRMEDALSKLVSECDAHHGNVSCPLIAALHCC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 5e-56 94
merR ACK44535.1 MerR Not tested SGI1 Protein 5e-46 75
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 5e-46 75
merR AFG30124.1 MerR Not tested PAGI-2 Protein 5e-46 75
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 7e-46 75
merR AGK07025.1 MerR Not tested SGI1 Protein 2e-45 74
merR AGK07083.1 MerR Not tested SGI1 Protein 2e-45 74
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 3e-46 74
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 4e-46 74
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 4e-44 71
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 5e-26 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alide_1829 YP_004126464.1 hg(ii)-responsive transcriptional regulator BAC0688 Protein 5e-47 76
Alide_1829 YP_004126464.1 hg(ii)-responsive transcriptional regulator BAC0683 Protein 8e-48 75
Alide_1829 YP_004126464.1 hg(ii)-responsive transcriptional regulator BAC0232 Protein 3e-46 75
Alide_1829 YP_004126464.1 hg(ii)-responsive transcriptional regulator BAC0687 Protein 3e-46 75
Alide_1829 YP_004126464.1 hg(ii)-responsive transcriptional regulator BAC0684 Protein 2e-47 74
Alide_1829 YP_004126464.1 hg(ii)-responsive transcriptional regulator BAC0686 Protein 2e-47 73
Alide_1829 YP_004126464.1 hg(ii)-responsive transcriptional regulator BAC0689 Protein 5e-45 73