Gene Information

Name : Alide_4029 (Alide_4029)
Accession : YP_004128622.1
Strain : Alicycliphilus denitrificans BC
Genome accession: NC_014910
Putative virulence/resistance : Virulence
Product : DNA repair protein radc
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2003
EC number : -
Position : 4201440 - 4201934 bp
Length : 495 bp
Strand : +
Note : KEGG: bpt:Bpet1083 DNA repair protein RadC-like protein; TIGRFAM: DNA repair protein RadC; PFAM: DNA repair protein RadC

DNA sequence :
ATGTCTTTCGCCGTCAATGACTCCTGCCTGGAGTCGCTTTCCGCCATCGCTGCCCAACACGAGGACTGGATCATCCAGCA
AGCCATCGTGCTGCTGGAGAGACGGGTCTTCAAAGCTGGACCGTGCCTCAGCCAACCGGCCGCTGTACGGGACTACCTGC
GTCTGAAACTGGTCGCTGAGCCCAATGAGATATTCGCCGCTGTGTTCCTGGACAGCCTGCACCAGGTGCTGGCCTACGAG
CCGCTGTTCAGGGGCACGATCAACGCGACTTCGGTCTATCCGCGTGTCGTCGTGCAGCGTGTGCTGGAGTTGAATGCCGC
CGCGGTGGTCTTCGCCCACCAGCATCCTTCGGGCGTCTCCGAGCCGTCCAGCGCGGATCGCATGCTGACCCAGCAACTGC
AAGCCGCGCTGGCGCTCATCGATGTGCGGGTACTGGACCACATCATCGTCGGCCAGGGTGCCCCGTTCTCCTTTGCGGAA
TCCGGCCTGCTGTAG

Protein sequence :
MSFAVNDSCLESLSAIAAQHEDWIIQQAIVLLERRVFKAGPCLSQPAAVRDYLRLKLVAEPNEIFAAVFLDSLHQVLAYE
PLFRGTINATSVYPRVVVQRVLELNAAAVVFAHQHPSGVSEPSSADRMLTQQLQAALALIDVRVLDHIIVGQGAPFSFAE
SGLL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
radC AAN62140.1 putative DNA repair protein RadC Not tested PAGI-2(C) Protein 3e-63 93
radC AAN62275.1 putative DNA repair protein RadC Not tested PAGI-3(SG) Protein 6e-36 61
VC0510 NP_230161.1 DNA repair protein RadC-like protein Not tested VSP-2 Protein 7e-24 50
VC1786 NP_231421.1 DNA repair protein RadC Not tested VPI-2 Protein 1e-25 49
VC0395_A1383 YP_001217326.1 DNA repair protein RadC Not tested VPI-2 Protein 1e-25 49
ECO103_3589 YP_003223446.1 radC-like protein YeeS Not tested LEE Protein 1e-20 49
VPI2_0034 ACA01849.1 DNA repair protein RadC Not tested VPI-2 Protein 6e-26 49
unnamed AAK00479.1 unknown Not tested SHI-1 Protein 1e-20 48
unnamed CAD42098.1 hypothetical protein Not tested PAI II 536 Protein 2e-20 48
yeeS CAE85201.1 YeeS protein Not tested PAI V 536 Protein 1e-20 48
z1217 CAD33787.1 Z1217 protein Not tested PAI I 536 Protein 2e-20 47
yeeS AAZ04458.1 putative RadC-like protein Not tested PAI I APEC-O1 Protein 4e-21 47
yeeS YP_854323.1 radC-like protein YeeS Not tested PAI I APEC-O1 Protein 6e-21 47
c5152 NP_757000.1 radC-like protein yeeS Not tested PAI II CFT073 Protein 6e-21 47
Z1657 NP_287160.1 RadC family DNA repair protein Not tested TAI Protein 2e-19 47
Z1217 NP_286752.1 RadC family DNA repair protein Not tested TAI Protein 2e-20 47
unnamed AAL08475.1 unknown Not tested SRL Protein 2e-20 47
yeeS ADD91702.1 YeeS Not tested PAI-I AL862 Protein 1e-20 47
yeeS CAI43846.1 YeeS protein Not tested LEE Protein 1e-20 47
yeeS CAI43901.1 YeeS protein Not tested LEE Protein 1e-20 47
aec73 AAW51756.1 Aec73 Not tested AGI-3 Protein 1e-20 47
unnamed CAD66203.1 hypothetical protein Not tested PAI III 536 Protein 1e-21 46
yeeS NP_838484.1 RADC family DNA repair protein Not tested SHI-1 Protein 1e-20 46
yeeS NP_708770.1 RADC family DNA repair protein Not tested SHI-1 Protein 1e-20 46
unnamed AAL67345.1 intergenic-region protein Not tested PAI II CFT073 Protein 7e-21 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alide_4029 YP_004128622.1 DNA repair protein radc VFG1119 Protein 3e-26 49
Alide_4029 YP_004128622.1 DNA repair protein radc VFG1617 Protein 7e-21 48
Alide_4029 YP_004128622.1 DNA repair protein radc VFG1528 Protein 6e-21 47
Alide_4029 YP_004128622.1 DNA repair protein radc VFG1066 Protein 6e-21 47
Alide_4029 YP_004128622.1 DNA repair protein radc VFG1678 Protein 6e-22 46
Alide_4029 YP_004128622.1 DNA repair protein radc VFG0660 Protein 3e-21 46