Gene Information

Name : Psesu_1876 (Psesu_1876)
Accession : YP_004146949.1
Strain : Pseudoxanthomonas suwonensis 11-1
Genome accession: NC_014924
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2073321 - 2074031 bp
Length : 711 bp
Strand : -
Note : KEGG: sml:Smlt1436 DNA-binding response regulator CreB; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
ATGGGGCGCGACTATGCTTGGCCGATGCCGACCGCGCCGCTGATCCTCATCGCCGACGACGAACCGGCGATCGCCGACAC
GCTGCTCTATGCCCTGCGCAGCGAGGGCCTGCAGGCCGAGCACTGCCTGCTCGGGCGCGAGGCGGTTGAGCGGGTGCGTG
CCGGCGGGGTCGACGTGCTGGTGCTGGACGTGGGCCTGCCGGACATCGGCGGCTTCGACGTCTGCCGCCAGGTGCGCGCT
TTCAGCGAGGTGCCGGTGATCTTCCTCACCGCGCGCGGCGAGGAGATCGACCGGGTGCTGGGCCTGGAGCTGGGCGGCGA
CGACTACGTGTCCAAGCCGTTCTCGCCGCGGGAGATGGTGGCGCGGGTGCGCGCACGCCTGCGCCGGCGCGCGCCGGCGG
ACGACGGCGCGGACTGGCAGGAGCGCGGCGATTTCGCCGTGGACCGCGCGGGACACCGCATCCGCTACCGCGGCCGGGTG
CTGGACCTGACCCGCTACGAGTACGCACTGCTGGAGGCGCTGCTGCAGCGCCCGGGCGCCATCCTCAGCCGCGCCCAGCT
GATGGACCGGGCCTGGGACAGCACCGCGGCCAGCGGCGACCGCACCGTCGACACCCATATCAAGACCCTGCGCGCCAAGC
TGCGTGCCGCCGGCGCCGAGCCGGACCCGATCCGCACCCACCGTGGCCTCGGCTACGCGATCGCGGCCTGA

Protein sequence :
MGRDYAWPMPTAPLILIADDEPAIADTLLYALRSEGLQAEHCLLGREAVERVRAGGVDVLVLDVGLPDIGGFDVCRQVRA
FSEVPVIFLTARGEEIDRVLGLELGGDDYVSKPFSPREMVARVRARLRRRAPADDGADWQERGDFAVDRAGHRIRYRGRV
LDLTRYEYALLEALLQRPGAILSRAQLMDRAWDSTAASGDRTVDTHIKTLRAKLRAAGAEPDPIRTHRGLGYAIAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 5e-18 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 5e-18 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 5e-18 41
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 5e-18 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 6e-28 43
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 5e-28 42
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 2e-27 42
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-27 41
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-27 41
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-27 41
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-27 41
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-27 41
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-27 41
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-27 41
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-27 41
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-27 41
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-27 41
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator BAC0596 Protein 2e-25 41
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator BAC0039 Protein 3e-27 41
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 2e-27 41
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 2e-25 41
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 3e-27 41
Psesu_1876 YP_004146949.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 2e-18 41