Gene Information

Name : SPSINT_2432 (SPSINT_2432)
Accession : YP_004150596.1
Strain : Staphylococcus pseudintermedius HKU10-03
Genome accession: NC_014925
Putative virulence/resistance : Virulence
Product : two-component response regulator SA14-24
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2589658 - 2590359 bp
Length : 702 bp
Strand : -
Note : -

DNA sequence :
ATGGCAAGAAAAGTAGTCGTAGTCGATGATGAAAAACCAATTGCGGATATATTAGAATTTAATTTGAAAAAAGAAGGTTA
TGAAGTATTTGTCGCATATGATGGCAACGATGCGGTCGACTTAATCTATGAAAAAGAACCTGATATCGTGTTACTCGATA
TTATGTTGCCTGGCCAAGACGGTATGGAAGTGTGCCGTGAAGTGCGTAAAAAATTCGAAATGCCAATTATTATGTTGACG
GCTAAAGACTCAGAGATCGATAAAGTCCTCGGTCTTGAGCTTGGTGCGGATGACTATGTGACAAAACCATTTAGTACGCG
TGAATTAATTGCACGTGTGAAAGCTAACTTACGCCGCCATTATACACAACCGAGTCAAGAAAATCACATGCAGACGAATG
AAATTACAATTAAAGATATTGTGATTTATCCAGATGCTTATTCTATTAAAAAACGCGGTGAAGATATTGATTTGACGCAC
CGTGAATTTGAGTTGTTCCATTATTTATCGAAACATATGGGACAAGTGATGACGCGTGAACATTTGCTCCAAACGGTATG
GGGTTATGATTATTTCGGTGATGTCCGTACTGTAGACGTTACGATTCGCCGTTTACGTGAAAAAATTGAAGATGATCCTT
CTCATCCAGACTATATTGTGACGCGTCGTGGTGTTGGATATTTCTTACAACAACATGATTAG

Protein sequence :
MARKVVVVDDEKPIADILEFNLKKEGYEVFVAYDGNDAVDLIYEKEPDIVLLDIMLPGQDGMEVCREVRKKFEMPIIMLT
AKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYTQPSQENHMQTNEITIKDIVIYPDAYSIKKRGEDIDLTH
REFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPDYIVTRRGVGYFLQQHD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-37 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_012469.1.7685629. Protein 3e-70 63
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_002952.2859905.p0 Protein 4e-55 52
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_007793.3914279.p0 Protein 4e-55 52
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_003923.1003749.p0 Protein 4e-55 52
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_007622.3794472.p0 Protein 3e-55 52
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_002745.1124361.p0 Protein 4e-55 52
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_009782.5559369.p0 Protein 4e-55 52
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_002951.3237708.p0 Protein 4e-55 52
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_002758.1121668.p0 Protein 4e-55 52
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_009641.5332272.p0 Protein 4e-55 52
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_013450.8614421.p0 Protein 4e-55 52
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 HE999704.1.gene2815. Protein 9e-51 49
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_012469.1.7686381. Protein 6e-47 48
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 AE016830.1.gene1681. Protein 2e-48 46
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_014475.1.orf0.gen Protein 2e-43 45
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_005054.2598277.p0 Protein 2e-43 45
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 AE000516.2.gene3505. Protein 4e-42 45
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 AF130997.1.orf0.gene Protein 7e-43 44
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 AM180355.1.gene1830. Protein 5e-46 44
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 FJ349556.1.orf0.gene Protein 2e-40 43
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 AF155139.2.orf0.gene Protein 1e-38 43
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 HE999704.1.gene1528. Protein 2e-35 42
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_002758.1121390.p0 Protein 6e-36 41
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_010079.5776364.p0 Protein 6e-36 41
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_002952.2859858.p0 Protein 6e-36 41
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_007622.3794948.p0 Protein 6e-36 41
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_003923.1003417.p0 Protein 6e-36 41
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_013450.8614146.p0 Protein 6e-36 41
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_002951.3238224.p0 Protein 6e-36 41
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 NC_007793.3914065.p0 Protein 6e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 VFG1702 Protein 6e-38 42
SPSINT_2432 YP_004150596.1 two-component response regulator SA14-24 VFG1563 Protein 4e-38 41