Gene Information

Name : Varpa_2659 (Varpa_2659)
Accession : YP_004154969.1
Strain : Variovorax paradoxus EPS
Genome accession: NC_014931
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2874074 - 2874802 bp
Length : 729 bp
Strand : +
Note : KEGG: vap:Vapar_2988 two component transcriptional regulator winged helix family; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
ATGGACACCCCCAAACGCGTGCTGATCGTCGAGGACGACGCCCACATCGCCGAACTGCTGCGCATGCACCTGCGCGACGA
AGGCTATGCCATCGAACACGCCGCCGACGGCCATGCGGGCCTGCGCGAACTGGAGCGCGGCAACTGGGACGCGCTGGTGC
TCGACCTGATGCTGCCCGGCGTCGACGGCCTCGAGATCTGCCGCCGAGCACGGGCCATGGCGCGCTACACGCCGATCATC
ATCATCAGCGCACGCTCGAGCGAAGTGCACCGCATCCTCGGGCTGGAGCTGGGCGCCGACGACTACCTGGCCAAGCCTTT
CTCGGTGCTGGAACTCGTGGCGCGCGTGAAGGCGCTGATGCGGCGCACCGATGCGCTGGCGCGCAATGCGCGCATGGAGT
CGGGCAGCCTCACGCTGGGCAACCTGGACATCGAACCGCTGGCGCGCGAGGTGCGCGTGGACGGCAAGCTCATCGAGCTC
ACGCCGCGCGAGTTCGACCTGCTGTACTTCTTTGCGCGCAACCCCGGCAAGGTGTTCTCGCGGCTCGACCTGCTCAACCA
GGTGTGGGGCTACCAGCACGACGGCTACGAGCACACGGTCAACACGCACATCAACCGGCTGCGCACGAAGGTGGAGACCG
ATCCGGCGGAGCCGAGGCGCATCCTTACCGTGTGGGGGCGGGGCTACAAGCTTTCGCCGACCGGCGCGGGCGATGAGGGA
GGGGCGTGA

Protein sequence :
MDTPKRVLIVEDDAHIAELLRMHLRDEGYAIEHAADGHAGLRELERGNWDALVLDLMLPGVDGLEICRRARAMARYTPII
IISARSSEVHRILGLELGADDYLAKPFSVLELVARVKALMRRTDALARNARMESGSLTLGNLDIEPLAREVRVDGKLIEL
TPREFDLLYFFARNPGKVFSRLDLLNQVWGYQHDGYEHTVNTHINRLRTKVETDPAEPRRILTVWGRGYKLSPTGAGDEG
GA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-71 61
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-72 61

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-39 46
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-42 43
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 3e-34 42
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-38 42
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-42 42
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-43 42
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-43 42
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-43 42
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-43 42
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-43 42
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-43 42
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-43 42
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-43 42
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-43 42
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-43 42
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 3e-42 42
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator VFG1563 Protein 8e-72 61
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-72 61
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-32 43
Varpa_2659 YP_004154969.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-37 41