Gene Information

Name : Varpa_0602 (Varpa_0602)
Accession : YP_004152934.1
Strain : Variovorax paradoxus EPS
Genome accession: NC_014931
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 670366 - 671049 bp
Length : 684 bp
Strand : -
Note : KEGG: rsl:RPSI07_mp1421 DNA-binding response regulator in two-component system; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
ATGAACATCCTGGTGGTCGAAGACGACGCGCGCGTCGCCGACTTTTTACAGAGAGGCCTCGGCGCCGAGGGCTACCGCGT
GCAGCTGGCCCGCACCGGACCCGAAGGCCTGGCTCTGGCGCGCGGCAGCGACCTTTCACTGCTGCTGCTCGACCTGATGC
TTCCCGGCCTGAGCGGCCTGGAGCTCTGCCAGACCTTGCGCGCCGAGGGCCACCACGTGCCCGTGCTGATGCTCACGGCG
CTCAGCAACACGCAGGACAAGGTGAGCGGCCTGCGCCTGGGCGCGGACGACTACCTCACCAAGCCCTTTGCCTTCGAGGA
GCTGCTCGCGCGCATCGAGGCGCTGCTGCGCCGCGGCCGCGAAATGCGGCCCCGCGCCACCACGCTGCAGGTGGCGGACC
TCGTGCTCGACCGCGAGCGCATGTCGGTGACGCGGGCCGGCAAGCCCGTGGCGCTGACCGCCAAGGAGCTCGCGTTCCTC
GAGCTGCTGATGACCGCGCCCGGCCGGGTCTACAGCCGCGAACGCATCCTCTCCAATGTCTGGGGCACCAACGAAGATCC
GCTGACCAACATCGTCGACGTCTATGTGCGGCGCCTGCGCGGCAAGATCGACGACGGCCATCCCGTGGCGTTGTTGCAGA
CGGTCCGCGGCCTGGGCTATCGGCTGGACCCCACCCCGGCCTGA

Protein sequence :
MNILVVEDDARVADFLQRGLGAEGYRVQLARTGPEGLALARGSDLSLLLLDLMLPGLSGLELCQTLRAEGHHVPVLMLTA
LSNTQDKVSGLRLGADDYLTKPFAFEELLARIEALLRRGREMRPRATTLQVADLVLDRERMSVTRAGKPVALTAKELAFL
ELLMTAPGRVYSRERILSNVWGTNEDPLTNIVDVYVRRLRGKIDDGHPVALLQTVRGLGYRLDPTPA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-25 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-24 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator BAC0308 Protein 4e-29 50
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-30 49
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator BAC0638 Protein 5e-24 49
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-28 47
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator BAC0111 Protein 3e-29 47
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-25 46
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator BAC0347 Protein 2e-25 46
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 3e-22 44
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 1e-18 44
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-22 43
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-22 43
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-22 43
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-22 43
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-22 43
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-22 43
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-22 43
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-22 43
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-18 41
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-25 46
Varpa_0602 YP_004152934.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-27 45