Gene Information

Name : Celal_4141 (Celal_4141)
Accession : YP_004166881.1
Strain : Cellulophaga algicola DSM 14237
Genome accession: NC_014934
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4730179 - 4730877 bp
Length : 699 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789; IPR001867; KEGG: fbc:FB2170_11161 response regulator DrrA; PFAM: Signal transduction response regulator, receiver domain

DNA sequence :
ATGAAGCAAATATTAATCATAGAAGACGATCCAGAAATAATTAAATTGTTAGAAATACATCTAACAGATTTAATTTACAC
TACAGCAAAGGCTATGGATGGAAAAGTTGGCTTAGCTATGGCTTTAGAAAATTCATATGATTTAATTCTGCTAGATCTAA
CATTACCAACTATGGATGGTATTGAAATTTGCAAAAAAATAAGAAGTCAAAAAAATACACCCATTATAATGCTTACTGCC
AAATCTGAAGAAATAGATCGTGTATTAGGCTTAGAAATTGGAGCAGACGATTACATCACAAAACCATTTAGCATTCGAGA
ACTGTTAGCCAGAGTTAAAGCTGTTTTACGCAGAACAGACATAAAACCTATTCCTCAAAAGGATACTTCCTCTATTTTGG
CAGAAGGGCTTAGTATAGATATAGATAAACGAAAAGTTATCTTAAACGATAAAAAAATTGAGCTTTCCCCAAAAGAATTT
GAACTCTTAGTTTTAATGGCTTCTAATCCTGGCAGAAATTATACCAGAACAGATTTATTAAACATGATCTGGGGGTACAA
TTTTGAAGGGTACGAACATACTGTAAACTCTCATATAAATAGATTAAGAGCAAAAATTGAATCTGATATGGCAAACCCCA
TTTTTATTCTTACAACCTGGGGAGTTGGTTACAAGTTCAATGAAGATATACTTGCATGA

Protein sequence :
MKQILIIEDDPEIIKLLEIHLTDLIYTTAKAMDGKVGLAMALENSYDLILLDLTLPTMDGIEICKKIRSQKNTPIIMLTA
KSEEIDRVLGLEIGADDYITKPFSIRELLARVKAVLRRTDIKPIPQKDTSSILAEGLSIDIDKRKVILNDKKIELSPKEF
ELLVLMASNPGRNYTRTDLLNMIWGYNFEGYEHTVNSHINRLRAKIESDMANPIFILTTWGVGYKFNEDILA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-48 46
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-47 46
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-42 47
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-42 47
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-42 47
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-42 47
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-42 47
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-42 47
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-42 47
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-42 47
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 2e-48 47
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 1e-43 47
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 1e-37 46
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 9e-50 46
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 4e-41 45
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-48 45
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 2e-39 45
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 8e-44 44
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-43 44
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 7e-44 44
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-43 44
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-43 44
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-43 44
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-43 44
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-43 44
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-43 44
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 9e-44 44
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 4e-41 43
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 6e-38 43
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family BAC0596 Protein 3e-36 43
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 6e-37 43
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family BAC0039 Protein 5e-37 43
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 3e-36 43
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 5e-37 43
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 6e-35 42
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 4e-40 42
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 4e-40 42
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 1e-36 42
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 2e-36 42
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 9e-37 41
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family AF130997.1.orf0.gene Protein 2e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family VFG1563 Protein 5e-48 46
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family VFG1702 Protein 2e-47 46
Celal_4141 YP_004166881.1 two component transcriptional regulator, winged helix family VFG0596 Protein 3e-34 41