Gene Information

Name : Deima_2164 (Deima_2164)
Accession : YP_004171469.1
Strain : Deinococcus maricopensis DSM 21211
Genome accession: NC_014958
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2337998 - 2338573 bp
Length : 576 bp
Strand : -
Note : COGs: COG2310 Uncharacterized protein involved in stress response homologs of TerZ and cAMP-binding protein CABP1; InterPro IPR003325; KEGG: bur:Bcep18194_B0270 stress protein; PFAM: Bacterial stress protein; SPTR: Stress protein; PFAM: Bacterial stress p

DNA sequence :
ATGGCGATTTCCCTCAGCAAAGGCGGCAACCTCAGCCTCACCAAACAGGACCCGACCCTCACGAACGTCCTCATTGGCCT
CGGCTGGGACGTGCGCGCCACCGAAGGGCAGGACTTCGACCTCGACGCGAGCGCGTTCCTGCTCGGCGCGAACGACAAGG
TCCGCAGCGACGCCGACTTCGTGTTCTACAACCAGCCGCGCAGCAGCGAAGGCAGCGTCGAACACACCGGCGACAACCGC
ACGGGCGCCGGCGAAGGTGACGACGAACAGGTCAAGATCGACCTGACCCGCGTTCCTGCCGACGTGCAGAAAATCGCGCT
GACCGTCACCATCCACGAAGCCGACGCGCGCCGCCAGAACTTCGGGCAGGTCCGCAACGCCTTCGTGCGCCTCATGAACG
AGCAGACCGGCACGGAAATCGTCCGCTTCGACCTCGGCGAGGACTTCAGCACCGAAACCGCCGTCGTGTTCGCGGAAGTC
TACCGCCACAACAACGAATGGAAGTTCCGCGCGGTCGGCCAGGGCTACGCCGGCGGCCTCCGCGCGCTCTGCAACGCCTA
CGGCATCATGATCTAA

Protein sequence :
MAISLSKGGNLSLTKQDPTLTNVLIGLGWDVRATEGQDFDLDASAFLLGANDKVRSDADFVFYNQPRSSEGSVEHTGDNR
TGAGEGDDEQVKIDLTRVPADVQKIALTVTIHEADARRQNFGQVRNAFVRLMNEQTGTEIVRFDLGEDFSTETAVVFAEV
YRHNNEWKFRAVGQGYAGGLRALCNAYGIMI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-68 71
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-64 67
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 8e-64 67
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-64 67
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-58 62
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-58 62
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-58 62
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-57 60
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-26 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deima_2164 YP_004171469.1 stress protein BAC0389 Protein 5e-64 67
Deima_2164 YP_004171469.1 stress protein BAC0390 Protein 1e-61 65