Gene Information

Name : Deima_0521 (Deima_0521)
Accession : YP_004169845.1
Strain : Deinococcus maricopensis DSM 21211
Genome accession: NC_014958
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 608342 - 609010 bp
Length : 669 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789: IPR001867; KEGG: dge:Dgeo_0195 two component transcriptional regulator; PFAM: Signal transduction response regulator, re

DNA sequence :
ATGGAACAACGCATTCTCCTGATCGAAGACAACCCGGACATCACCCGCGTCGTCCAGTACGAACTGGAACAGAGTGGGTA
CCGTGTCCTCTCCGCCCCCGACGGCATCACCGGCCTCACGAGCGCCCGAGAGAACAACCCGGACCTCGTGATTCTCGACC
TGGGCCTCCCGGACTTCGACGGCGCCGAAATCGCCCGTCGACTCCGCAAAACCAGCGCCGTCCCCATCATCATCCTCACC
GCCATGGACGCCGTCGACCGCAAAGTAAACCTGCTCGAAGCCGGCGCCGACGACTACATGACCAAACCCTTCCACCCGGA
AGAACTGGTCGCGCGCGTCAAGGTCCAGTTGCGTCACCAGCAGCACGGCGAAGTCATCCAGATCGGCGCGCTCGAAATCC
ACCCACAGAAGCGCCTCTGCCACTACAACGGCCACGAAGTGCGCCTCAGCCCCAAAGAATTCGACCTGCTCACCTTCCTC
GCCCGCCAGCCCGGCCGCGTGTACTCCCGCCAGGAAATCGAACGGGAAGTCTGGAACGGCGAACTGCCCAGCAACAGCAA
CGTCGTGGACGTCCACATGGCCAACATGCGCGCCAAGCTCCGCGACCTCGACGGGTACGGCATCATCCGCACCGTCCGCG
GCATCGGCTACGCCCTCAAGACCCCCTAA

Protein sequence :
MEQRILLIEDNPDITRVVQYELEQSGYRVLSAPDGITGLTSARENNPDLVILDLGLPDFDGAEIARRLRKTSAVPIIILT
AMDAVDRKVNLLEAGADDYMTKPFHPEELVARVKVQLRHQQHGEVIQIGALEIHPQKRLCHYNGHEVRLSPKEFDLLTFL
ARQPGRVYSRQEIEREVWNGELPSNSNVVDVHMANMRAKLRDLDGYGIIRTVRGIGYALKTP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-31 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deima_0521 YP_004169845.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-35 42
Deima_0521 YP_004169845.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-35 42
Deima_0521 YP_004169845.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-35 42
Deima_0521 YP_004169845.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-35 42
Deima_0521 YP_004169845.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-35 42
Deima_0521 YP_004169845.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-35 42
Deima_0521 YP_004169845.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-35 42
Deima_0521 YP_004169845.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-35 42
Deima_0521 YP_004169845.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-35 42
Deima_0521 YP_004169845.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-35 42
Deima_0521 YP_004169845.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 9e-38 41
Deima_0521 YP_004169845.1 winged helix family two component transcriptional regulator BAC0197 Protein 6e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deima_0521 YP_004169845.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-31 42
Deima_0521 YP_004169845.1 winged helix family two component transcriptional regulator VFG1389 Protein 9e-31 42