Gene Information

Name : Deima_0586 (Deima_0586)
Accession : YP_004169910.1
Strain : Deinococcus maricopensis DSM 21211
Genome accession: NC_014958
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 676154 - 676831 bp
Length : 678 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789: IPR001867; KEGG: ddr:Deide_01470 response regulator, CheY; PFAM: Signal transduction response regulator, receiver domain

DNA sequence :
ATGGAACGCAAGCCCCTGGTCCTCGTGATCGAGGATGAAAAAGATATTGCCCGCTTCATCGAACTGGAGCTCGCCGCCGA
AGGCTACGCCACCGAAGTCGCCTTCGACGGCGTGACCGGCCTGAGCAAATTCCGCGAAGTCAACCCCGACCTCGTGATCC
TCGACCTCATGCTCCCCGTCCTCGACGGCCTGGAGGTCGCCCGCCGCATCCGCAAGACCAGCAACACTCCCATTATCATC
CTCACCGCCAAGGACAACATCCAGGACAAGGTCGAAGGCCTCGACAGCGGCGCCGACGACTACCTCGTCAAGCCCTTCAG
CATCGAGGAACTGCTCGCCCGCGTGCGCGCGCACCTGCGCCGCGTGAACCCCGCCGTGACCGGCGAGGTGCGCGTCGCCG
ACCTCGTCATGAACCTCGACGGCCGCGAGATCTTCCGCGGGGGCCGCCGCGTGGAACTGAGCGCCAAGGAGTTCGAGCTG
CTCGAACTGCTCGCCCGCAACCCCGGCAAGGTCTTCTCCCGCTTCGAGATCGAGGAGAAGGTCTGGCCGGAGTACACCGG
CGGCAGCAACGTCGTGGACGTGTATATCGGCTACCTGCGCCGCAAGCTCGAGGAGGGCGGCGAGCGCCGCCTGATCCACA
CCGTGCGCGGCGTCGGCTACGTCCTGCGCGAGGAATAA

Protein sequence :
MERKPLVLVIEDEKDIARFIELELAAEGYATEVAFDGVTGLSKFREVNPDLVILDLMLPVLDGLEVARRIRKTSNTPIII
LTAKDNIQDKVEGLDSGADDYLVKPFSIEELLARVRAHLRRVNPAVTGEVRVADLVMNLDGREIFRGGRRVELSAKEFEL
LELLARNPGKVFSRFEIEEKVWPEYTGGSNVVDVYIGYLRRKLEEGGERRLIHTVRGVGYVLREE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-28 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-27 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 7e-33 48
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator BAC0125 Protein 5e-35 47
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-33 46
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-33 46
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-33 46
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-33 46
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-33 46
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-33 46
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-33 46
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-28 46
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-33 46
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-27 45
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator BAC0197 Protein 5e-30 45
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-30 43
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-32 43
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-26 42
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator BAC0111 Protein 3e-29 42
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator BAC0638 Protein 9e-23 42
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-25 41
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 8e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator VFG1390 Protein 5e-37 50
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator VFG1389 Protein 4e-26 46
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-28 44
Deima_0586 YP_004169910.1 winged helix family two component transcriptional regulator VFG1386 Protein 9e-29 42