Gene Information

Name : ANT_28720 (ANT_28720)
Accession : YP_004175498.1
Strain : Anaerolinea thermophila UNI-1
Genome accession: NC_014960
Putative virulence/resistance : Virulence
Product : OmpR family two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3183178 - 3183855 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence :
ATGAAAGAACGCATTTTAATCATTGAAGACGATGAAGGAATCGTTCGCGTTCTGAAGCGCGCTTTGACCTACGAAGGATA
TCTGGTAGAAAGTGCGCTGGAGGGGGAAACCGGTCTGCAATTAGCGCGCGAGCATCGCCCCGACCTGATCATCCTGGACT
GGATGCTCCCCGGCATGGACGGGCTGGAAGTCTGCCAGCGCCTGCGCACCCTCTGCAACGCTCCCATCCTGATGCTGACA
GCCAAGGACACCCTGCAGGATCGCGTTCAGGGGCTGGATGCCGGCGCCGATGATTACATGACCAAACCTTTCGAACTGGA
AGAACTGCTGGCACGCATCCGCGCCCTCCTGCGCCGCACCCAGATGGAACGCGCTCCCGTGCTTTCGTTTGCCGACCTGA
CCCTCGATACCTCTACCCGGCAAGCCACTCGTGGCAACCGCACCATTCCCTTAACCGCCAAGGAATACGACCTGCTGGAA
CTCTTCCTGCGGCATCCACGCCAGGTGCTCACCCGCGAGATGATTTTCGACCGCGTGTGGGGCTATGACTTCGGCGGGGA
GAGCAACGTGCTGGATGTGTACATCCGCTACCTGCGGCAAAAACTGGAAAGCGATGGAGAGCCCCGCCTGCTCCATACCG
TGCGCGGGGTAGGATACGTGCTGAGAGAAACCCCCTGA

Protein sequence :
MKERILIIEDDEGIVRVLKRALTYEGYLVESALEGETGLQLAREHRPDLIILDWMLPGMDGLEVCQRLRTLCNAPILMLT
AKDTLQDRVQGLDAGADDYMTKPFELEELLARIRALLRRTQMERAPVLSFADLTLDTSTRQATRGNRTIPLTAKEYDLLE
LFLRHPRQVLTREMIFDRVWGYDFGGESNVLDVYIRYLRQKLESDGEPRLLHTVRGVGYVLRETP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-31 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ANT_28720 YP_004175498.1 OmpR family two-component response regulator BAC0197 Protein 5e-37 49
ANT_28720 YP_004175498.1 OmpR family two-component response regulator BAC0308 Protein 2e-35 48
ANT_28720 YP_004175498.1 OmpR family two-component response regulator AE000516.2.gene3505. Protein 4e-40 46
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_002952.2859905.p0 Protein 2e-34 45
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_009641.5332272.p0 Protein 3e-34 45
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_013450.8614421.p0 Protein 3e-34 45
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_007793.3914279.p0 Protein 3e-34 45
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_002745.1124361.p0 Protein 3e-34 45
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_009782.5559369.p0 Protein 3e-34 45
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_002951.3237708.p0 Protein 3e-34 45
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_003923.1003749.p0 Protein 3e-34 45
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_002758.1121668.p0 Protein 3e-34 45
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_007622.3794472.p0 Protein 2e-34 45
ANT_28720 YP_004175498.1 OmpR family two-component response regulator BAC0125 Protein 9e-36 45
ANT_28720 YP_004175498.1 OmpR family two-component response regulator BAC0083 Protein 3e-34 45
ANT_28720 YP_004175498.1 OmpR family two-component response regulator BAC0638 Protein 5e-26 45
ANT_28720 YP_004175498.1 OmpR family two-component response regulator HE999704.1.gene1528. Protein 2e-40 44
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_013450.8614146.p0 Protein 9e-38 43
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_002951.3238224.p0 Protein 9e-38 43
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_007793.3914065.p0 Protein 9e-38 43
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_002758.1121390.p0 Protein 9e-38 43
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_010079.5776364.p0 Protein 9e-38 43
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_002952.2859858.p0 Protein 9e-38 43
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_007622.3794948.p0 Protein 9e-38 43
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_003923.1003417.p0 Protein 9e-38 43
ANT_28720 YP_004175498.1 OmpR family two-component response regulator BAC0111 Protein 1e-34 43
ANT_28720 YP_004175498.1 OmpR family two-component response regulator HE999704.1.gene2815. Protein 3e-31 43
ANT_28720 YP_004175498.1 OmpR family two-component response regulator AE015929.1.gene1106. Protein 8e-32 42
ANT_28720 YP_004175498.1 OmpR family two-component response regulator BAC0347 Protein 2e-32 42
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_012469.1.7686381. Protein 3e-32 41
ANT_28720 YP_004175498.1 OmpR family two-component response regulator NC_012469.1.7685629. Protein 3e-30 41
ANT_28720 YP_004175498.1 OmpR family two-component response regulator FJ349556.1.orf0.gene Protein 1e-29 41
ANT_28720 YP_004175498.1 OmpR family two-component response regulator AF155139.2.orf0.gene Protein 4e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ANT_28720 YP_004175498.1 OmpR family two-component response regulator VFG1390 Protein 8e-53 56
ANT_28720 YP_004175498.1 OmpR family two-component response regulator VFG1386 Protein 3e-43 48
ANT_28720 YP_004175498.1 OmpR family two-component response regulator VFG1389 Protein 1e-38 45
ANT_28720 YP_004175498.1 OmpR family two-component response regulator VFG0596 Protein 2e-31 43
ANT_28720 YP_004175498.1 OmpR family two-component response regulator VFG0473 Protein 2e-21 41