Gene Information

Name : GM18_4078 (GM18_4078)
Accession : YP_004200769.1
Strain : Geobacter sp. M18
Genome accession: NC_014973
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4791903 - 4792577 bp
Length : 675 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: transcriptional regulator domain-containing protein; response regulator receiver; KEGG: gbm:Gbem_3615 two component heavy metal response transcriptional regulator, winged helix family; SMART: response regulat

DNA sequence :
ATGCGCATCCTGATCATCGAAGACGAGCAGAAAGCCGCCAACTATCTGAAGAAGGGGCTCAGCGAAAACGGCTTCAGCGT
CGACATCGCCAATAATGGCGAGGATGGCCTGCACCTGGCCATGACCGAGGCCTACGACCTGATCATCCTGGACGTCATGC
TCCCGATCAAGGGGGGATGGGCCATCATCAAGGAGTTGCGGGATGCGGGGAACGACGTGCCGGTCATCTTCCTTTCCGCG
CGCGACGCGGTGCATGACCGGGTCCATGGCCTGGAGCTTGGGGCCGACGACTACCTGGTGAAGCCCTACGCCTTCTCGGA
ACTGCTCGCCCGGATCAGGATCATCCTGCGCCGGCACCCCCTGCAGCAATCGGAACTCTTGAAGATGGCCGACCTGGAGT
TGGACCTGATCCGGCACAAGGCCAGGCGCGGCGGGCACTCCCTCGACCTCACCGTCAAGGAGTTCCAGCTCTTGGCGCTT
ATGCTCAGGCGCAGGGGTGAGGTGCTGACCCGCACCACCATCTCCGAACAGGTCTGGGGCATCAACTTCGACAGCGACAC
CAACGTGGTCGATGTCGCCATCAGAAGGCTCAGGAAAAAGGTGGACGACCCGTTCCCCTTAAAGCTCATCCACACCATCC
GGGGGGTCGGCTATGTCATCGATGAAGCTGCCTGA

Protein sequence :
MRILIIEDEQKAANYLKKGLSENGFSVDIANNGEDGLHLAMTEAYDLIILDVMLPIKGGWAIIKELRDAGNDVPVIFLSA
RDAVHDRVHGLELGADDYLVKPYAFSELLARIRIILRRHPLQQSELLKMADLELDLIRHKARRGGHSLDLTVKEFQLLAL
MLRRRGEVLTRTTISEQVWGINFDSDTNVVDVAIRRLRKKVDDPFPLKLIHTIRGVGYVIDEAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-52 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-51 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 3e-63 64
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 3e-59 62
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 2e-51 58
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 5e-57 57
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 3e-59 55
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 2e-55 54
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 4e-51 52
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 4e-34 44
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 4e-34 44
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 4e-34 44
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 4e-34 44
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 4e-34 44
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 4e-34 44
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 4e-34 44
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 4e-34 44
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 3e-31 44
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 2e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 5e-53 54
GM18_4078 YP_004200769.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 1e-33 44