Gene Information

Name : GM18_0625 (GM18_0625)
Accession : YP_004197382.1
Strain : Geobacter sp. M18
Genome accession: NC_014973
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 773031 - 773708 bp
Length : 678 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; KEGG: gbm:Gbem_3465 two component transcriptional regulator, winged helix family; SMART: response regulator receiver; transcri

DNA sequence :
ATGAATTTCCTGATCATAGAAGATTCCGAAAAGACAGCCGAGCAGTTGAGGAAAGGGCTTGCCGAAGTCAGCATCAACGC
GGACATCGCCGGCGACGGCCTCAGGGGGCTCGCCATGGCGAAGGAGAAGGATTACGAGCTGATCATCCTCGATCTGATGC
TCCCGGGGATCGACGGTTTCGAGGTGGTGAAGAGGCTGCGTAGCGCCGGCAAGAGCACCCCGGTAATCATGCTGACGGCG
CGCGACGACGTGCACGACCGGATCTGCGGCCTGCAGTCCGGCGCCGACGACTACATGGTGAAGCCCTTCTCCTTCGGGGA
GCTCTGCGCCCGCATCCAGGCGCTTTTGCGCCGCGGCCAGGTGCTGCAGCAGGACGAGATCCAGGTCGCGGACCTGACGG
TGAACTTCTTCGCCCGCAAGGCGACCCGCGGCGGAAAACACCTGGAGCTTACCCCCAAGGAGTTCGCGCTCCTCTCGATG
CTGATCCGCCGCGCCGGGGAGGTGCAGTCCCGGTTGCGTATCGCTGAAACCGTGTGGAACCTGGGATTCGACGCCAACTT
GAAGATCGTGGACGTGAAACTGGCCGGGCTGAGGGCGAAGGTGGACGGCCCCTTCGAGAAGAAGTTGATCCACACGGTGC
GCGGCGTAGGTTACGTGCTAGAGGACCGGGATGTCTGA

Protein sequence :
MNFLIIEDSEKTAEQLRKGLAEVSINADIAGDGLRGLAMAKEKDYELIILDLMLPGIDGFEVVKRLRSAGKSTPVIMLTA
RDDVHDRICGLQSGADDYMVKPFSFGELCARIQALLRRGQVLQQDEIQVADLTVNFFARKATRGGKHLELTPKEFALLSM
LIRRAGEVQSRLRIAETVWNLGFDANLKIVDVKLAGLRAKVDGPFEKKLIHTVRGVGYVLEDRDV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-46 51
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-45 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 8e-54 54
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 1e-51 53
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 4e-54 52
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 9e-55 51
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 7e-49 48
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 4e-50 48
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 2e-43 47
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 9e-34 44
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 9e-34 44
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 9e-34 44
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 9e-34 44
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 9e-34 44
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 9e-34 44
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 9e-34 44
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 9e-34 44
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 5e-29 41
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-33 41
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-33 41
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-33 41
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-33 41
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-33 41
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-33 41
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-33 41
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-33 41
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-33 41
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 1e-46 51
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family VFG0473 Protein 5e-29 45
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 2e-39 41
GM18_0625 YP_004197382.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 2e-33 41