Gene Information

Name : TSC_c21620 (TSC_c21620)
Accession : YP_004203314.1
Strain : Thermus scotoductus SA-01
Genome accession: NC_014974
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2044185 - 2044859 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGGAACCTCCCCTCATCCTGATCGTGGAGGACGAAAAGGACATCGCCCGCTTCATCGAGCTGGAACTGCAAGCCGAGGG
CTACCGCACCGAGGTGGCCTACGACGGCATCACCGGCCTTTCCCGCTTCCGGGAGGTGAACCCCAACCTGGTGATCCTGG
ACCTGATGCTTCCCGTCATGGACGGGATCGAGGTGGCCAAGCGCATCCGCAAGACCTCCAACGTGCCCATCCTCATCCTC
ACCGCCAAGGACCGCATCGAGGACAAGGTGGAGGGCCTGGACGCCGGAGCCGACGACTACCTGGTGAAGCCCTTTTCCAT
AGAGGAGCTCCTGGCCCGGGTGCGGGCCCACCTGCGCCGGGTGAGCCCGGCCATCACCGGGGAGATCAGGGTGGCGGACC
TCATCATCAACCTCGAGGGCCGGGAGGTTTTCCGAAGCGGGCGGCGCATCGAGCTTTCCAACAAGGAGTTCGAGCTCCTG
GAACTTCTCGCCAAGAACCCCGGGAAGGTCTTCAGCCGCTACGAGATTGAGGAAAAGGTCTGGCCCGGCTACCAGGGGGG
AAGCAACGTGGTGGACGTCTACATCGGCTACCTGCGCAAGAAGCTGGAGGCCGCAGGGGAAAGGCGCCTGATCCACACGG
TGCGGGGCGTGGGGTACGTGCTCCGTGAGGATTGA

Protein sequence :
MEPPLILIVEDEKDIARFIELELQAEGYRTEVAYDGITGLSRFREVNPNLVILDLMLPVMDGIEVAKRIRKTSNVPILIL
TAKDRIEDKVEGLDAGADDYLVKPFSIEELLARVRAHLRRVSPAITGEIRVADLIINLEGREVFRSGRRIELSNKEFELL
ELLAKNPGKVFSRYEIEEKVWPGYQGGSNVVDVYIGYLRKKLEAAGERRLIHTVRGVGYVLRED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-31 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-30 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-26 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TSC_c21620 YP_004203314.1 response regulator NC_010079.5776364.p0 Protein 1e-37 51
TSC_c21620 YP_004203314.1 response regulator NC_002952.2859858.p0 Protein 1e-37 51
TSC_c21620 YP_004203314.1 response regulator NC_007622.3794948.p0 Protein 1e-37 51
TSC_c21620 YP_004203314.1 response regulator NC_003923.1003417.p0 Protein 1e-37 51
TSC_c21620 YP_004203314.1 response regulator NC_013450.8614146.p0 Protein 1e-37 51
TSC_c21620 YP_004203314.1 response regulator NC_002951.3238224.p0 Protein 1e-37 51
TSC_c21620 YP_004203314.1 response regulator NC_007793.3914065.p0 Protein 1e-37 51
TSC_c21620 YP_004203314.1 response regulator NC_002758.1121390.p0 Protein 1e-37 51
TSC_c21620 YP_004203314.1 response regulator HE999704.1.gene1528. Protein 8e-39 50
TSC_c21620 YP_004203314.1 response regulator BAC0125 Protein 1e-38 48
TSC_c21620 YP_004203314.1 response regulator AE015929.1.gene1106. Protein 1e-32 46
TSC_c21620 YP_004203314.1 response regulator NC_012469.1.7685629. Protein 2e-31 46
TSC_c21620 YP_004203314.1 response regulator BAC0308 Protein 9e-36 45
TSC_c21620 YP_004203314.1 response regulator BAC0197 Protein 8e-33 45
TSC_c21620 YP_004203314.1 response regulator BAC0111 Protein 9e-34 44
TSC_c21620 YP_004203314.1 response regulator AE000516.2.gene3505. Protein 3e-33 44
TSC_c21620 YP_004203314.1 response regulator AF155139.2.orf0.gene Protein 8e-31 43
TSC_c21620 YP_004203314.1 response regulator BAC0347 Protein 1e-28 43
TSC_c21620 YP_004203314.1 response regulator NC_002952.2859905.p0 Protein 1e-31 43
TSC_c21620 YP_004203314.1 response regulator NC_002745.1124361.p0 Protein 2e-31 43
TSC_c21620 YP_004203314.1 response regulator NC_009782.5559369.p0 Protein 2e-31 43
TSC_c21620 YP_004203314.1 response regulator NC_002951.3237708.p0 Protein 2e-31 43
TSC_c21620 YP_004203314.1 response regulator NC_003923.1003749.p0 Protein 3e-31 43
TSC_c21620 YP_004203314.1 response regulator NC_007622.3794472.p0 Protein 1e-31 43
TSC_c21620 YP_004203314.1 response regulator NC_002758.1121668.p0 Protein 2e-31 43
TSC_c21620 YP_004203314.1 response regulator NC_009641.5332272.p0 Protein 2e-31 43
TSC_c21620 YP_004203314.1 response regulator NC_013450.8614421.p0 Protein 2e-31 43
TSC_c21620 YP_004203314.1 response regulator NC_007793.3914279.p0 Protein 2e-31 43
TSC_c21620 YP_004203314.1 response regulator BAC0638 Protein 8e-28 43
TSC_c21620 YP_004203314.1 response regulator BAC0083 Protein 1e-33 42
TSC_c21620 YP_004203314.1 response regulator Y16952.3.orf35.gene. Protein 2e-20 41
TSC_c21620 YP_004203314.1 response regulator HE999704.1.gene2815. Protein 2e-30 41
TSC_c21620 YP_004203314.1 response regulator U82965.2.orf14.gene. Protein 2e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TSC_c21620 YP_004203314.1 response regulator VFG1390 Protein 1e-43 49
TSC_c21620 YP_004203314.1 response regulator VFG1389 Protein 6e-36 45
TSC_c21620 YP_004203314.1 response regulator VFG0596 Protein 9e-32 43
TSC_c21620 YP_004203314.1 response regulator VFG1386 Protein 4e-36 43
TSC_c21620 YP_004203314.1 response regulator VFG1563 Protein 3e-26 41
TSC_c21620 YP_004203314.1 response regulator VFG1702 Protein 3e-26 41