
|
Name : TSC_c03880 (TSC_c03880) Accession : YP_004201574.1 Strain : Thermus scotoductus SA-01 Genome accession: NC_014974 Putative virulence/resistance : Resistance Product : heavy metal-binding protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 331379 - 331579 bp Length : 201 bp Strand : - Note : - DNA sequence : ATGCTGAAACTCAAGGTAGAAGGCATGACCTGCAACCACTGCGTGATGGCGGTCAAGAAGGCCCTCATGAAGGTGCCCGG GGTGGAGAAGGCCGAGGTGAGCCTGGAACGGGCCGAGGCCCTGGTGGAGGGCAAGGCGGACCCCGAGGCCTTGATCCGGG CCGTGGAAGAGGAAGGCTACCGGGCCGCCCTGGCGGGCTAA Protein sequence : MLKLKVEGMTCNHCVMAVKKALMKVPGVEKAEVSLERAEALVEGKADPEALIRAVEEEGYRAALAG |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 3e-11 | 48 |
| merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 4e-09 | 43 |
| merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 4e-09 | 43 |
| merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 4e-09 | 43 |
| merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 4e-09 | 43 |
| merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 4e-09 | 43 |
| merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 6e-09 | 43 |
| merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 4e-10 | 41 |
| merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 6e-10 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| TSC_c03880 | YP_004201574.1 | heavy metal-binding protein | BAC0675 | Protein | 4e-08 | 41 |
| TSC_c03880 | YP_004201574.1 | heavy metal-binding protein | BAC0231 | Protein | 3e-09 | 41 |