Gene Information

Name : MTES_3426 (MTES_3426)
Accession : YP_004226270.1
Strain : Microbacterium testaceum StLB037
Genome accession: NC_015125
Putative virulence/resistance : Virulence
Product : response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3707249 - 3707923 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence :
GTGTCCACCCCTGCCCGCGTCCTCGTGCTCGACGACGACGAGACCATCCGACTGAGCGTCGTGACGGCGCTGCGCGCCGA
AGGCTTCACCGCCGAGGGCGCTCCGGACGGCACGGATCTGACGGCTCGGCTGTCGGCTTTCCGCCCCGACCTCGTGGTGC
TGGACTGGATGATGCCCGGGCCGGCCGGCATCCGTTTGCTCCCCGTGATCCGAGCGGAGGGCGACACCGCGGTGATCATG
CTGACCGCTCGCGATGAGGTCGACGATCGCCTGCGCGGGTTCGCGGAGGGGGCGGACGATTACGTGACCAAGCCGTTCAC
GGTGGCCGAGCTCGTGGCGCGTACGGGCGCGGTGCTGCGTCGGCGTGGACGCCTCCCTCAGACGATCGCGATCGGCGATC
TCGTCGTCGATCCGGACGCGGCCGTCGCCCATCGCGCGGGCGGGCCCCTCGATCTGACGGCGACCGAGTTCCGGTTGTTG
CAGCTGCTCGCGGAGAGCCGCGGGCGCACGCTGTCGAAGGGACAGATCCTCACCCAGGTGTGGGGGTACGACGACTACGA
CCCCAACCTCGTCGAGGTGCATCTGAGCGCTCTCCGGCGCAAGATGGAGGCCCGCGGGCCGCGGCTCATCCACACCGTGC
GCGGCCTCGGCTACCGACTGAGCGTCGCCCCGTGA

Protein sequence :
MSTPARVLVLDDDETIRLSVVTALRAEGFTAEGAPDGTDLTARLSAFRPDLVVLDWMMPGPAGIRLLPVIRAEGDTAVIM
LTARDEVDDRLRGFAEGADDYVTKPFTVAELVARTGAVLRRRGRLPQTIAIGDLVVDPDAAVAHRAGGPLDLTATEFRLL
QLLAESRGRTLSKGQILTQVWGYDDYDPNLVEVHLSALRRKMEARGPRLIHTVRGLGYRLSVAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 9e-23 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 9e-23 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 9e-23 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 9e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MTES_3426 YP_004226270.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0638 Protein 2e-21 42
MTES_3426 YP_004226270.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0083 Protein 1e-28 41
MTES_3426 YP_004226270.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE000516.2.gene3505. Protein 5e-29 41
MTES_3426 YP_004226270.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000034.1.gene3834. Protein 2e-19 41
MTES_3426 YP_004226270.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002695.1.915041.p Protein 2e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MTES_3426 YP_004226270.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1389 Protein 4e-34 47
MTES_3426 YP_004226270.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1390 Protein 8e-33 43
MTES_3426 YP_004226270.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1386 Protein 1e-33 41