Gene Information

Name : BC1001_4417 (BC1001_4417)
Accession : YP_004230874.1
Strain :
Genome accession: NC_015137
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 912895 - 913572 bp
Length : 678 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; KEGG: bgf:BC1003_2093 winged helix family two component transcriptional regulator; SMART: response regulator receiver; transcr

DNA sequence :
ATGCGTATCCTGGTGATCGAAGACGAGCCGAAAACAGGCGCGTACCTGAAAAAAGGCCTGGAAGAATCCGGCTATTCTGT
CGACCTCGCCAACGATGGTGCTGACGGCCTGCTGCTCGCACAGGAGCAGGACTACGACGTGATCGTCCTCGACGTGATGC
TGCCGACAATGGACGGTTGGGCCGTGCTGAAAGTACTGCGCGCGACTCATACCACGCCGGTGCTGTTCCTTACCGCGCGC
GACGACGTGAACGACCGCGTACGTGGTCTCGAACTCGGCGGCGACGATTACCTCGTCAAACCATTTGCGTTTGTCGAACT
GCTGGCACGGGTGCGTACGTTGGCGCGGCGCGGTCCGCCGCGCGAGAGCGAACTTCTCGCGATCGGCGACCTGGAGATGG
ACATCAACCGGCGGCGCGTGAAACGCGGCGCAACGCGTATCGACCTCACGCCCCGCGAGTTCTCGCTGTTGCAACTGCTT
TTGCGTCGTCAGGGCGAGGTGCTGAGCCGCACGCAGATCGCTTCATACGTGTGGGACATGAACTTCGACAGCGATACGAA
CGTGGTCGAGGTGGCGATTCGCCGCTTGCGCGCGAAGATCGACGACGCTTTCCCCGTCAAGCTGATCCAGACCGTGCGCG
GCGTCGGATATGTAATCGAAGCCAAAGAGCCGGACTGA

Protein sequence :
MRILVIEDEPKTGAYLKKGLEESGYSVDLANDGADGLLLAQEQDYDVIVLDVMLPTMDGWAVLKVLRATHTTPVLFLTAR
DDVNDRVRGLELGGDDYLVKPFAFVELLARVRTLARRGPPRESELLAIGDLEMDINRRRVKRGATRIDLTPREFSLLQLL
LRRQGEVLSRTQIASYVWDMNFDSDTNVVEVAIRRLRAKIDDAFPVKLIQTVRGVGYVIEAKEPD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-53 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-52 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 5e-67 68
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 2e-67 64
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 8e-66 62
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 3e-55 61
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 7e-61 59
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 1e-59 57
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 4e-55 53
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 3e-35 42
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 3e-35 42
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 3e-35 42
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 3e-35 42
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 3e-35 42
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 3e-35 42
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 3e-35 42
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 3e-35 42
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-31 42
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-31 42
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-31 42
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-31 42
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-31 42
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-31 42
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-31 42
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-31 42
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-31 42
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 6e-28 42
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-29 41
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 3e-31 41
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 2e-26 41
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 3e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 9e-54 56
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 4e-35 48
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 2e-36 45
BC1001_4417 YP_004230874.1 two component heavy metal response transcriptional regulator, winged helix family VFG1386 Protein 1e-33 42