Gene Information

Name : Acav_2295 (Acav_2295)
Accession : YP_004234774.1
Strain : Acidovorax avenae ATCC 19860
Genome accession: NC_015138
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2562176 - 2562868 bp
Length : 693 bp
Strand : -
Note : KEGG: rsl:RPSI07_mp1421 DNA-binding response regulator in two-component system; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver doma

DNA sequence :
ATGAGCATCGCGCAGATCCTGGTCGTCGAGGACGATCCCCGCGTCGCCGATTTCCTGCAGCGCGGCCTGCGCGCGGAGGG
CTACGGCGTGCAGATGGCGCGCACCGGACCCGAAGGGCTGGAGCTCGCCCGCGCAGGGGAAGCGACACTGTTGATCCTCG
ACGTGATGCTGCCCGGCATGACCGGGCTGGACCTGTGCCAGTCGCTGCGGGCCGAAGGCGGCCAGGTGCCGGTGCTGATG
CTCACGGCCCTGAGCAGCATCGAAGACAAGGTCGCAGGACTGAAGCTCGGCGCGGACGACTACCTCACCAAGCCGTTCGC
CTTCGAGGAACTGCTGGCGCGCATCGAGGCGCTGCTGCGGCGCGGGCGCGAGCAGCGCCCCCGGGCGACCAGGCTGCAGG
TGGCGGACCTGGTGCTTGACCTGGAACGCATGCAGGCCAGCCGCGCGGGCCGTCCGATCGCGCTCACAGCCAAGGAACTG
GCCTTCCTGGAACTGCTCATGAGCGCCCCGGGCCGTCTCTGCAGCCGCGAGCGCATCCTCTCCAACGTGTGGGGCATGCA
CGAGGACCCGCTGACGAACGTGGTGGATGTCTATGTGCGCCGCCTGCGCAGCAAGATCGACGAAGGACACCCTCTGGCAC
TGCTCAAGACCGTGCGCGGGCTGGGCTACCGCCTGGACGACGGCGAGGCCTAG

Protein sequence :
MSIAQILVVEDDPRVADFLQRGLRAEGYGVQMARTGPEGLELARAGEATLLILDVMLPGMTGLDLCQSLRAEGGQVPVLM
LTALSSIEDKVAGLKLGADDYLTKPFAFEELLARIEALLRRGREQRPRATRLQVADLVLDLERMQASRAGRPIALTAKEL
AFLELLMSAPGRLCSRERILSNVWGMHEDPLTNVVDVYVRRLRSKIDEGHPLALLKTVRGLGYRLDDGEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-35 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-34 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acav_2295 YP_004234774.1 winged helix family two component transcriptional regulator BAC0125 Protein 4e-39 49
Acav_2295 YP_004234774.1 winged helix family two component transcriptional regulator BAC0638 Protein 5e-35 49
Acav_2295 YP_004234774.1 winged helix family two component transcriptional regulator BAC0347 Protein 2e-35 48
Acav_2295 YP_004234774.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-36 48
Acav_2295 YP_004234774.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-40 48
Acav_2295 YP_004234774.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-35 48
Acav_2295 YP_004234774.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-39 46
Acav_2295 YP_004234774.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 3e-31 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acav_2295 YP_004234774.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-35 46
Acav_2295 YP_004234774.1 winged helix family two component transcriptional regulator VFG1390 Protein 6e-36 44
Acav_2295 YP_004234774.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-33 41