Gene Information

Name : Deipr_1307 (Deipr_1307)
Accession : YP_004256073.1
Strain : Deinococcus proteolyticus MRP
Genome accession: NC_015161
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1384287 - 1384952 bp
Length : 666 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: dge:Dgeo_2149 two component transcriptional regulator; PFAM: Signal transduction response regulator, rec

DNA sequence :
ATGAGCGAACATCACATCTTGATCATCGAGGACGACTTAGACATCGCCAACGTCCTGAAACTTGACCTGACCGACGCCGG
GTACGAGGTGGATCACGCTGACGTGGCGATGACTGGCCTGATCAAGGCCCGCGAAGACAACCCGGACCTGATCATTCTGG
ACCTGGGCCTGCCCGACTTCGACGGCGGCGATGTGGTGCAGCGCCTGCGCAAGAACAGCGCCGTGCCCATCATCGTGCTG
ACGGCCCGTGACACGGTGGACGAGAAGGTCCGGCTGCTGGGCCTGGGCGCCGACGACTACATCATCAAGCCGTTCCACCC
CGACGAGCTGCTGGCCCGCGTCAAGGTGCAGCTGCGCCAGCGCGTGACCGAGAGCCTCAGCATGGGCGACCTGACCCTGG
ACCCCCAAAAGCGCCTGGCGACCTACAAGGGCGAGGAACTGCGCCTGAGTCCCAAGGAATTCGACATTCTCAGCCTGCTG
ATTCGCCAGCCGGGACGGGTGTACTCGCGCCAGGAAATCGGCCAGGAAATCTGGCAGGGCCGCCTTCCCGAAGGCAGCAA
CGTGGTGGACGTGCACATGGCGAACCTGCGCGCCAAGCTGCGTGACCTGGACGGCTACGGCCTGCTGCGCACCGTGCGCG
GCGTGGGCTACGCGCTGCGCGGCTGA

Protein sequence :
MSEHHILIIEDDLDIANVLKLDLTDAGYEVDHADVAMTGLIKAREDNPDLIILDLGLPDFDGGDVVQRLRKNSAVPIIVL
TARDTVDEKVRLLGLGADDYIIKPFHPDELLARVKVQLRQRVTESLSMGDLTLDPQKRLATYKGEELRLSPKEFDILSLL
IRQPGRVYSRQEIGQEIWQGRLPEGSNVVDVHMANLRAKLRDLDGYGLLRTVRGVGYALRG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-24 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family BAC0083 Protein 5e-26 46
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family BAC0347 Protein 2e-21 43
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family BAC0197 Protein 5e-28 43
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-21 42
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 1e-25 42
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family BAC0125 Protein 1e-23 41
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-21 41
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-21 41
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-21 41
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-21 41
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-21 41
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-21 41
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-21 41
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-21 41
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-21 41
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family BAC0111 Protein 9e-22 41
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 6e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family VFG1390 Protein 2e-21 43
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family VFG0596 Protein 6e-25 42
Deipr_1307 YP_004256073.1 two component transcriptional regulator, winged helix family VFG1389 Protein 6e-23 42