Gene Information

Name : Deipr_0147 (Deipr_0147)
Accession : YP_004254938.1
Strain : Deinococcus proteolyticus MRP
Genome accession: NC_015161
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 153509 - 154177 bp
Length : 669 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: dge:Dgeo_0195 two component transcriptional regulator; PFAM: Signal transduction response regulator, rec

DNA sequence :
ATGGAGCAGCGGATTTTGGTCATCGAGGATAACCCGGATATCAGCCGGGTGGTGCAGTATGAACTGGAGCAGGCCGGCTA
CGAGGCGCTGACCGCGCCCGACGGCATCAGTGGACTGACACTGGCCCGCGAGGAGCACCCCGATCTGGTCATTTTGGACC
TGGGCCTGCCTGACCTGGACGGCGCCGAGGTAACCCGCCGCCTGCGCAAGAACAGCTCCATGCCCATCATCATCCTGACC
GCGATGGACGCACTGGACCGCAAGGTGGCGCTGCTGGAAGCCGGCGCCGACGACTACATGACCAAGCCTTTCTACCCCGA
GGAACTGGTCGCCCGCGTCAAGGTGCAGCTGCGCCACCAGCAGCACGGCGACGTGATCCGGGTGGGCGACCTGGAAATTC
ATCCCCAGAAGCGGCTGTGCTACTTCAAGGGTCACGAGGTGCGGCTCTCGCCCCGCGAGTTCGACCTACTCACGTTCCTG
GCGCGGCAGCCGGGCCGGGTCTATTCCCGCGCCGAAATCGAGCGCGAGGTGTGGAGTGGCGACCTGCCCAGCAACTCCAA
CGTGGTGGATGTCCACATGGCCAACATGCGCTCCAAGCTGCGCGACCTGGACGGCTACGGCCTGATTCGCACGGTGCGCG
GTATCGGCTACGCTCTCAAGACGCCCTGA

Protein sequence :
MEQRILVIEDNPDISRVVQYELEQAGYEALTAPDGISGLTLAREEHPDLVILDLGLPDLDGAEVTRRLRKNSSMPIIILT
AMDALDRKVALLEAGADDYMTKPFYPEELVARVKVQLRHQQHGDVIRVGDLEIHPQKRLCYFKGHEVRLSPREFDLLTFL
ARQPGRVYSRAEIEREVWSGDLPSNSNVVDVHMANMRSKLRDLDGYGLIRTVRGIGYALKTP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-31 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-36 44
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 3e-36 44
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 3e-36 44
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-36 44
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 3e-36 44
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 3e-36 44
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 3e-36 44
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 3e-36 44
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 3e-36 44
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family BAC0197 Protein 2e-32 44
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 3e-36 43
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 8e-40 42
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 7e-32 41
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 7e-32 41
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 7e-32 41
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 7e-32 41
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 7e-32 41
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 7e-32 41
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 7e-32 41
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 7e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family VFG1389 Protein 7e-31 43
Deipr_0147 YP_004254938.1 two component transcriptional regulator, winged helix family VFG0596 Protein 1e-31 42