Gene Information

Name : Celly_2950 (Celly_2950)
Accession : YP_004263638.1
Strain : Cellulophaga lytica DSM 7489
Genome accession: NC_015167
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3368446 - 3369138 bp
Length : 693 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789: IPR001867; KEGG: fbc:FB2170_11161 response regulator DrrA; PFAM: Signal transduction response regulator, receiver domain

DNA sequence :
ATGAAACAGATACTTATTATTGAAGACGATCCAGAAATTATTCAATTACTGGAAATACATTTAACAGATATGGTGTATAC
CACAACTAAAGCTATGGATGGTGAAACCGGCCTAAATTTAGCTTTAGAAAACGATTATGATCTTATTTTGCTTGATCTAA
CTTTACCTATTATGGATGGTATTGAGGTTTGTAAAAAACTAAGAATCAAAAAAAATACTCCTGTTATAATGCTTACTGCC
AAGTCTGAAGAAATTGACCGCGTGTTAGGTTTAGAAATTGGTGCAGACGATTATTTAACAAAACCTTTTAGCATTAGAGA
ATTGCTTGCACGTATAAAAGCTGTTTTACGTAGGTCTGATGCTCCCAAGGTTGAAGAAAACAATTCTACTACCTTAAATT
TTGAAGGACTTTTTATAGATATTGATAAGCGTAAAGTACTACATAACAAACAAAAAATAGATTTATCTCCTAAAGAGTTT
GAATTGTTGGTTTTAATGGCATCTAACCCAGGTAGAAATTACTCTAGAACAGAGCTCTTAAATATTATTTGGGGGTATAA
TTTTGAAGGCTATGAGCATACTGTAAACTCTCATATTAATAGGTTACGTGCAAAAATAGAATCTAATATGGCACAACCAA
TGTACATACTTACCACTTGGGGAGTTGGCTATAAATTTAATGAAGAAATATAA

Protein sequence :
MKQILIIEDDPEIIQLLEIHLTDMVYTTTKAMDGETGLNLALENDYDLILLDLTLPIMDGIEVCKKLRIKKNTPVIMLTA
KSEEIDRVLGLEIGADDYLTKPFSIRELLARIKAVLRRSDAPKVEENNSTTLNFEGLFIDIDKRKVLHNKQKIDLSPKEF
ELLVLMASNPGRNYSRTELLNIIWGYNFEGYEHTVNSHINRLRAKIESNMAQPMYILTTWGVGYKFNEEI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-45 49
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-45 48
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-35 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-34 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-49 46
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-46 46
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 4e-48 45
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-42 44
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-44 44
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-44 44
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-44 44
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-44 44
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-44 44
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-44 44
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-44 44
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-44 44
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-44 44
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-44 44
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-39 43
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-39 43
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-39 43
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-39 43
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-39 43
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-39 43
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-39 43
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-39 43
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 7e-41 43
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-39 43
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 4e-35 42
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 4e-37 42
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-40 42
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator BAC0125 Protein 4e-36 41
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 1e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator VFG1563 Protein 6e-46 49
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator VFG1702 Protein 1e-45 48
Celly_2950 YP_004263638.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-35 43