Gene Information

Name : Sgly_3173 (Sgly_3173)
Accession : YP_004267440.1
Strain : Syntrophobotulus glycolicus DSM 8271
Genome accession: NC_015172
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3211557 - 3212243 bp
Length : 687 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789: IPR001867; KEGG: tjr:TherJR_2684 two component transcriptional regulator, winged helix family; PFAM: Signal transduction

DNA sequence :
ATGAAAACCAGAATCCTGGTCATTGAAGATGAAGTGAAAATAGCCCGTTTCCTGGAGCTGGAGCTGACTTATGAGGGTTA
TGCCGTGGAAGTTGCCCACGATGGCCGCAGCGGTTATGAAAAGGCTGCTGCGGGCAATGTTGATTTAATTATCCTGGATC
TGATGCTCCCGGAATTGAGTGGGATTGAAGTATGCAGGCGGGTGAGAAAGGAATCTGATGTGCCGATCATCATGCTGACC
GCCAAAGATGATGTTTCGGATAAGGTTATGGGTCTGGACAGCGGGGCCGATGATTATATGACCAAATCCTTTGCGATCGA
GGAATTGCTGGCAAGAATAAGGGTGATTTTAAAAAGAAAAAGCAAAAAAGAGGGAAGCTCCGCTGTTATAGCGGCAGGCA
GGCTTGTTTTATTGAGGGATGAACACCGAGTCACCTTTGAGGGCAAAGAGATATCCTTATCCAAGAAAGAATTTGAACTG
TTAAAATATTTAATGGAAAATAAAGGAATAGTGCTATCCAGAGAAAAGATTCTTGATCATGTCTGGGGGTATGACTATTA
TGGGGATACCAATGTCACAGATGTGTACATCAAGTATTTGCGCAATAAAATAGATCAGAAGTTCGATGTGCGCTTTATTC
ATACGGTGAGAGGAGTTGGGTATATTTTTAAACAGGATGAAGAATGA

Protein sequence :
MKTRILVIEDEVKIARFLELELTYEGYAVEVAHDGRSGYEKAAAGNVDLIILDLMLPELSGIEVCRRVRKESDVPIIMLT
AKDDVSDKVMGLDSGADDYMTKSFAIEELLARIRVILKRKSKKEGSSAVIAAGRLVLLRDEHRVTFEGKEISLSKKEFEL
LKYLMENKGIVLSREKILDHVWGYDYYGDTNVTDVYIKYLRNKIDQKFDVRFIHTVRGVGYIFKQDEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 4e-52 53
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 4e-52 53
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 4e-52 53
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 4e-52 53
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 4e-52 53
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 4e-52 53
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 4e-52 53
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 4e-52 53
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 2e-47 51
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 6e-48 50
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 3e-45 45
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family BAC0308 Protein 1e-40 44
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family BAC0125 Protein 8e-42 44
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 7e-40 44
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 5e-40 44
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 5e-40 44
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 7e-40 44
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 5e-40 44
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 5e-40 44
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 5e-40 44
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 5e-40 44
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 5e-40 44
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family BAC0197 Protein 3e-40 44
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family BAC0083 Protein 4e-41 43
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 4e-40 43
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 3e-42 42
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 9e-40 42
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family BAC0638 Protein 3e-35 42
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 5e-36 41
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 5e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family VFG1386 Protein 1e-44 44
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family VFG1390 Protein 9e-48 43
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family VFG1389 Protein 6e-42 42
Sgly_3173 YP_004267440.1 two component transcriptional regulator, winged helix family VFG0596 Protein 5e-36 41