Gene Information

Name : ACMV_P1_01240 (ACMV_P1_01240)
Accession : YP_004277062.1
Strain :
Genome accession: NC_015178
Putative virulence/resistance : Unknown
Product : putative transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 116521 - 116868 bp
Length : 348 bp
Strand : -
Note : -

DNA sequence :
GTGATCCCGGTCTCGGCCGGTGTGCGGATCTGGCTGGCGTCGGGGCATACGGATATGCGCCGCGGGATGAAGGGGCTCGC
GTTGCAAGTGCAAGAAGGTCTGGGACGGGAACCGTTCTGCGGGGATGTTTTTTTCTTTCGCGGACGCGGCGGGTTGCTGG
TCAAGGCGATCTGGCACGACGGCGTGGGGATGTCGCTGTATTCGAAACGCCTTGATCGAGGGCGGTTTATCTGGCCGCAG
ACTGCGGACGGCGTTGTGTCCCTCACCGCTGGTCAGATCGGTTATCTTCTGGAGGGGATCGACTGGCGAAATCCACAACA
AACCTGGCGGCCGCAAGCGGCCGGGTAG

Protein sequence :
MIPVSAGVRIWLASGHTDMRRGMKGLALQVQEGLGREPFCGDVFFFRGRGGLLVKAIWHDGVGMSLYSKRLDRGRFIWPQ
TADGVVSLTAGQIGYLLEGIDWRNPQQTWRPQAAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 7e-25 55
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 7e-25 55
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-25 55
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-25 55
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-25 55
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-25 55
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-25 55
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-25 55
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-25 55
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-25 55
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-25 55
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-25 55
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 7e-20 54
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 6e-27 54
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 6e-27 54
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 3e-26 53
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 3e-26 53
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-26 53
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-25 53
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 3e-24 51
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 8e-24 48
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 8e-24 48
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-24 48
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-24 48
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-24 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ACMV_P1_01240 YP_004277062.1 putative transposase VFG0792 Protein 4e-26 55
ACMV_P1_01240 YP_004277062.1 putative transposase VFG1698 Protein 4e-26 55
ACMV_P1_01240 YP_004277062.1 putative transposase VFG1709 Protein 4e-26 55
ACMV_P1_01240 YP_004277062.1 putative transposase VFG1517 Protein 3e-20 54
ACMV_P1_01240 YP_004277062.1 putative transposase VFG1665 Protein 5e-27 53
ACMV_P1_01240 YP_004277062.1 putative transposase VFG1052 Protein 8e-26 53
ACMV_P1_01240 YP_004277062.1 putative transposase VFG1737 Protein 5e-25 46