Gene Information

Name : ACMV_P1_00370 (ACMV_P1_00370)
Accession : YP_004276975.1
Strain :
Genome accession: NC_015178
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 33937 - 34614 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence :
ATGAGGGTTCTTATCGTCGAGGACGAGGCGAAGACCGCAGCCTATCTCCGAAAGGGTCTCGAAGAGAACGGCTTCACGAC
GGATGTGGCTACTGATGGAGAGACGGGGCTCCAATTCGCCCGCCACGGCGGCTACGATGCCATTATCCTCGACATCATGC
TGCCACGGCGCGACGGCTTCGAAATCCTCGCCGAAATCCGGCGGCGCGACAGCCATACCGCCGTGCTTCTACTCACCGCG
CGGGACCAGGTGACAGATCGCGTCGCCGGGCTGGAGGCCGGGGCCGACGATTACCTCGTCAAGCCCTTCGCGTTTTCCGA
GCTGCTTGCCCGTGTGCGCACCATCCTGCGGCGAGGGCACGCGCGGCAACCGGCGCTGATCCAGATCGCCGATCTCGAGA
TTGACCTCTCGGGACACCGGGCAACGCGAGCGGGTCAGGCGCTCGATCTGACGCCGAAGGAGTTCCGCCTGCTTTCGTTG
TTGGCCCGCCGCGCGGGCGATGTCATCTCGCGAACGGTCATTGCCGAACAGGTCTGGGACATCAATTTCGATTCTGGCAC
GAACGTCGTCGACGTCCACATGTACCGCCTCCGCGCCAAGCTGGACGACCCGTTCTCCCGCCGCCTGATCCACACCGTTC
GTGGTGTGGGTTACGTGCTCGAAGACCGTGGCGGCTGA

Protein sequence :
MRVLIVEDEAKTAAYLRKGLEENGFTTDVATDGETGLQFARHGGYDAIILDIMLPRRDGFEILAEIRRRDSHTAVLLLTA
RDQVTDRVAGLEAGADDYLVKPFAFSELLARVRTILRRGHARQPALIQIADLEIDLSGHRATRAGQALDLTPKEFRLLSL
LARRAGDVISRTVIAEQVWDINFDSGTNVVDVHMYRLRAKLDDPFSRRLIHTVRGVGYVLEDRGG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-52 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-51 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ACMV_P1_00370 YP_004276975.1 two-component response regulator BAC0197 Protein 2e-63 61
ACMV_P1_00370 YP_004276975.1 two-component response regulator BAC0125 Protein 7e-61 58
ACMV_P1_00370 YP_004276975.1 two-component response regulator BAC0111 Protein 4e-56 55
ACMV_P1_00370 YP_004276975.1 two-component response regulator BAC0083 Protein 9e-56 55
ACMV_P1_00370 YP_004276975.1 two-component response regulator BAC0638 Protein 1e-50 55
ACMV_P1_00370 YP_004276975.1 two-component response regulator BAC0308 Protein 2e-55 53
ACMV_P1_00370 YP_004276975.1 two-component response regulator BAC0347 Protein 1e-49 51
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-37 45
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-37 45
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-37 45
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-37 45
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-37 45
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-37 45
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-37 45
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-37 45
ACMV_P1_00370 YP_004276975.1 two-component response regulator AE000516.2.gene3505. Protein 1e-33 45
ACMV_P1_00370 YP_004276975.1 two-component response regulator AE015929.1.gene1106. Protein 2e-34 43
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_012469.1.7685629. Protein 8e-32 41
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_002952.2859905.p0 Protein 2e-36 41
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_002951.3237708.p0 Protein 5e-36 41
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_003923.1003749.p0 Protein 4e-36 41
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_002758.1121668.p0 Protein 5e-36 41
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_007622.3794472.p0 Protein 2e-36 41
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_009641.5332272.p0 Protein 5e-36 41
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_013450.8614421.p0 Protein 5e-36 41
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_007793.3914279.p0 Protein 5e-36 41
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_002745.1124361.p0 Protein 5e-36 41
ACMV_P1_00370 YP_004276975.1 two-component response regulator NC_009782.5559369.p0 Protein 5e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ACMV_P1_00370 YP_004276975.1 two-component response regulator VFG0596 Protein 9e-53 53
ACMV_P1_00370 YP_004276975.1 two-component response regulator VFG1389 Protein 3e-38 47
ACMV_P1_00370 YP_004276975.1 two-component response regulator VFG1386 Protein 3e-37 43
ACMV_P1_00370 YP_004276975.1 two-component response regulator VFG1390 Protein 3e-39 42