Gene Information

Name : AGROH133_04874 (AGROH133_04874)
Accession : YP_004278212.1
Strain :
Genome accession: NC_015183
Putative virulence/resistance : Virulence
Product : two component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 906754 - 907425 bp
Length : 672 bp
Strand : +
Note : Response regulator receiver domain; Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGCGTATTCTCGTGGTTGAGGACGATGCCAATCTCAATCGTCAGCTGACCGACGCGCTGAAAGAAGCCGGTTATGTTGT
CGATCAGGCATTTGACGGCGAGGAAGGCCATTATCTCGGCGATACCGAACCCTATGACGCGATCGTTCTCGATATCGGCC
TGCCGCAGATGGACGGCATCACCGTCGTCGAGAAATGGCGCGCGGCGGGCAAGGCCATGCCGGTCCTCATTCTCACCGCC
CGTGACCGCTGGAGCGACAAGGTGGCGGGCATCGATGCCGGTGCCGACGATTACGTGACCAAGCCCTTCCATGTGGAAGA
AGTTCTTGCCCGCGTGCGTGCGCTCATCCGCCGCGCCGCTGGCCACGCTTCCTCCGAACTCGTCTGCGGACCGGTCAAGC
TCGATACCAAATCCTCCAAGGCAACGGTCAACGGCGTGACGCTGAAGCTCACCTCGCATGAGTTCCGCCTGCTTTCCTAT
CTCATGCATCACATGGGCGAGGTCGTCTCGCGCACGGAGCTGGTCGAACATATGTACGATCAGGATTTCGACAGGGATTC
CAACACGATCGAGGTGTTTGTCGGACGTTTGCGCAAAAAGCTCGGGGTTGATCTGATCGAGACCATCCGTGGCCTCGGTT
ACCGGATGCAAGCGCCGGCAGATGCGAAGTAG

Protein sequence :
MRILVVEDDANLNRQLTDALKEAGYVVDQAFDGEEGHYLGDTEPYDAIVLDIGLPQMDGITVVEKWRAAGKAMPVLILTA
RDRWSDKVAGIDAGADDYVTKPFHVEEVLARVRALIRRAAGHASSELVCGPVKLDTKSSKATVNGVTLKLTSHEFRLLSY
LMHHMGEVVSRTELVEHMYDQDFDRDSNTIEVFVGRLRKKLGVDLIETIRGLGYRMQAPADAK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AGROH133_04874 YP_004278212.1 two component response regulator NC_002516.2.879194.p Protein 6e-39 48
AGROH133_04874 YP_004278212.1 two component response regulator CP000647.1.gene1136. Protein 1e-35 46
AGROH133_04874 YP_004278212.1 two component response regulator BAC0530 Protein 1e-35 46
AGROH133_04874 YP_004278212.1 two component response regulator CP001918.1.gene2526. Protein 4e-35 45
AGROH133_04874 YP_004278212.1 two component response regulator CP004022.1.gene1005. Protein 7e-39 44
AGROH133_04874 YP_004278212.1 two component response regulator CP001138.1.gene1939. Protein 6e-36 44
AGROH133_04874 YP_004278212.1 two component response regulator BAC0111 Protein 2e-31 43
AGROH133_04874 YP_004278212.1 two component response regulator CP000034.1.gene2022. Protein 1e-35 43
AGROH133_04874 YP_004278212.1 two component response regulator NC_002695.1.913289.p Protein 4e-35 43
AGROH133_04874 YP_004278212.1 two component response regulator BAC0347 Protein 6e-28 42
AGROH133_04874 YP_004278212.1 two component response regulator BAC0197 Protein 1e-29 42
AGROH133_04874 YP_004278212.1 two component response regulator BAC0487 Protein 6e-26 42
AGROH133_04874 YP_004278212.1 two component response regulator BAC0083 Protein 1e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AGROH133_04874 YP_004278212.1 two component response regulator VFG0475 Protein 6e-36 44
AGROH133_04874 YP_004278212.1 two component response regulator VFG1389 Protein 2e-28 42
AGROH133_04874 YP_004278212.1 two component response regulator VFG0596 Protein 1e-26 41
AGROH133_04874 YP_004278212.1 two component response regulator VFG0473 Protein 1e-27 41