Gene Information

Name : Dester_0709 (Dester_0709)
Accession : YP_004281415.1
Strain : Desulfurobacterium thermolithotrophum DSM 11699
Genome accession: NC_015185
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 727405 - 728076 bp
Length : 672 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789: IPR001867; KEGG: sat:SYN_00981 response regulator; PFAM: Signal transduction response regulator, receiver domain; Signal

DNA sequence :
ATGGTAGTCTTGTTAGTCGAAGATGATGAAGATCTTGGAGAACTTTTAAAGTATAACCTTGAAAAAAATCAATTTAAAGT
TGACTGGACTCTTGATGGAAAAGAAGCTTTAGAGAAAATAAAAACAAACAGTTATGATTTAATCATTCTTGATCTTATGC
TCCCAGGAGCAAGTGGGCTTGATATCTGTAAGGAAATAAGAGAAAACTCCATTAATAAAGATGTTCCTGTAATTGTTTTA
ACGGCTCTTTCAGATGAAGATACGAAAGTAAAAGGTTTTTCCATAGGAGCTGATGATTATGTAACAAAACCTTTCAGTAT
GAAAGAACTCCTTGCTAGAATAGAAGCTGTCTTAAGAAGAGCTGGTTACGTTCGTAAAGCCATATTAGAGTTTGACGGAA
TAGTTTATGACAAAAGATCCAAAAGTGTTACAGTAGATGGAAATTCTATCTATCTAACAAAAACAGAGTTCCAGCTTCTT
GAGTTTTTCCTTGAACATCCAGAACAGCTCTTTTCAAGGGAAGAACTCCTTGAAAAAATCTGGGGACACGACCATAACGA
AACAACAAGGACAGTTGATGTTTATATAAGTAGATTAAGAAAGAAACTTGGAGATAAAGGAAAATATCTAAAGACTTTAC
CAAGACTGGGGTATAAGTTGACTAAGGAGTGA

Protein sequence :
MVVLLVEDDEDLGELLKYNLEKNQFKVDWTLDGKEALEKIKTNSYDLIILDLMLPGASGLDICKEIRENSINKDVPVIVL
TALSDEDTKVKGFSIGADDYVTKPFSMKELLARIEAVLRRAGYVRKAILEFDGIVYDKRSKSVTVDGNSIYLTKTEFQLL
EFFLEHPEQLFSREELLEKIWGHDHNETTRTVDVYISRLRKKLGDKGKYLKTLPRLGYKLTKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 7e-26 41
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 2e-25 41
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 7e-26 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 7e-26 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 7e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 5e-37 45
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 5e-37 45
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 5e-37 45
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 5e-37 45
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 5e-37 45
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 5e-37 45
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 5e-37 45
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 5e-37 45
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 3e-33 44
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 3e-27 44
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 4e-27 44
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 3e-27 44
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 3e-33 42
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-33 42
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-33 42
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-33 42
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-33 42
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-33 42
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-33 42
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-33 42
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-33 42
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 2e-32 42
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 3e-33 41
Dester_0709 YP_004281415.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 6e-26 41