Gene Information

Name : NAL212_1247 (NAL212_1247)
Accession : YP_004294316.1
Strain : Nitrosomonas sp. AL212
Genome accession: NC_015222
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1155245 - 1155931 bp
Length : 687 bp
Strand : +
Note : KEGG: neu:NE1409 response regulator PhoP; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver domain; Signal transduction response regul

DNA sequence :
ATGCGCATTCTGGTCATTGAGGATGAATTCAAATTACAAAACCAGATTCGCCAGCAGCTGGAAACCGCGGGCTATATGAT
CGACACATGCAGCGATGGCGATGAAGGCCTATTTCTTGCTTCAGAATACCCTTTGGATGCCGCCATCATTGATATCGGCT
TGCCGGGAAAATCCGGGCTGGAAATTATCAAAACCCTGCGTGAGCGCGGCAATCTGCTGCCCATTCTTATCCTGACCGCC
CGCAGCAGCTGGCAAGATAAAGTACAAGGTCTGGAAATGGGCGCGGATGATTACCTCACCAAACCATTTCAAATGGAAGA
GTTGCTGGCCAGAGTAAAAGCATTGCTGCGTCGTGCGACCGGCATACCGCAGACACTCTTAAAATGTGGCCCCATTACAG
TGGATGTCACGGCTCAATCCGTTGCCATCAACGAGGTAGAAATCGAGCTCACCTCGTTTGAATATCGCCTGCTGGAAGAA
TTGGTGCGCCATCACGGCGAGGTTCTCTCCAAGCACACATTATCCGACTACCTTTACCCACACGACGAAGATCGTGACAG
CAATGTGCTTGAGGTCATGATCGGCCGGTTGCGCCGCAAACTCGATCCCGATGGCACTTTGAATCCCATTGAAACCATGC
GCGGCCGCGGTTATCGCTTTACCCTGGAATGCAATAAATCGTCATGA

Protein sequence :
MRILVIEDEFKLQNQIRQQLETAGYMIDTCSDGDEGLFLASEYPLDAAIIDIGLPGKSGLEIIKTLRERGNLLPILILTA
RSSWQDKVQGLEMGADDYLTKPFQMEELLARVKALLRRATGIPQTLLKCGPITVDVTAQSVAINEVEIELTSFEYRLLEE
LVRHHGEVLSKHTLSDYLYPHDEDRDSNVLEVMIGRLRRKLDPDGTLNPIETMRGRGYRFTLECNKSS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-22 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 2e-51 51
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family CP000034.1.gene2022. Protein 4e-41 44
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family NC_002695.1.913289.p Protein 9e-40 44
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family CP001918.1.gene2526. Protein 2e-40 44
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family BAC0083 Protein 8e-25 44
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family BAC0308 Protein 3e-24 44
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family BAC0638 Protein 1e-19 44
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family CP004022.1.gene1005. Protein 2e-40 43
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family CP000647.1.gene1136. Protein 4e-41 43
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family CP001138.1.gene1939. Protein 8e-42 43
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family BAC0530 Protein 4e-41 43
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family BAC0288 Protein 5e-24 41
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-20 41
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-20 41
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-20 41
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-20 41
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-20 41
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-20 41
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-20 41
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family VFG0475 Protein 7e-42 43
NAL212_1247 YP_004294316.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-22 41