Gene Information

Name : YE105_C3312 (YE105_C3312)
Accession : YP_004299509.1
Strain : Yersinia enterocolitica 105.5R(r)
Genome accession: NC_015224
Putative virulence/resistance : Unknown
Product : putative IS3 transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 3825244 - 3825561 bp
Length : 318 bp
Strand : +
Note : -

DNA sequence :
ATGCTCAATACTCGTCGGCCTAAACGCACATTTTCCCCGGTGTTCAAACTCGAAGCTGTCGAGCAGGTTGTTAAATACCA
GCGCGATGCTAGAGAAATCGCACTGGCGCTCGAACTTGACCCTGCTCATTTGCGCAAGTGGATACGGCTGTATAAGCGGG
AACTCCAGGGAATAGAGCCAGTTGGCAATGCCATCACACCCGAACAACGCGAAATTCAGCAGCTTAAAAACCAAATAAAA
CGCCTTGAAATGGAAAAAGAAATACTAAAGCAGGCTGTCGTGCTGATGAGCGAAATCCCCAAAAAGCTATCGCGCTAA

Protein sequence :
MLNTRRPKRTFSPVFKLEAVEQVVKYQRDAREIALALELDPAHLRKWIRLYKRELQGIEPVGNAITPEQREIQQLKNQIK
RLEMEKEILKQAVVLMSEIPKKLSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 4e-37 84
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 2e-37 80
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-11 41
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-11 41
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-11 41
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-11 41
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-11 41
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-11 41
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-11 41
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-11 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
YE105_C3312 YP_004299509.1 putative IS3 transposase VFG1566 Protein 2e-37 84
YE105_C3312 YP_004299509.1 putative IS3 transposase VFG1521 Protein 7e-38 80
YE105_C3312 YP_004299509.1 putative IS3 transposase VFG1123 Protein 4e-12 41