Gene Information

Name : ragA (SL003B_2901)
Accession : YP_004304628.1
Strain : Polymorphum gilvum SL003B-26A1
Genome accession: NC_015259
Putative virulence/resistance : Virulence
Product : response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3129485 - 3130168 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
ATGCGGATCCTGATCATCGAGGACGACAAGCAGGCTGCAGCCTATCTCGCCAAGGGGCTGCGCGAGGTCGGCCATGTCGC
CGACCATGCCGCCGACGGCGAGGAGGGGCTGGAGCGCGCCCTCGACGGAGACTATGACGTGATGATCGTCGACCGGATGC
TGCCGCGCCGCGACGGCCTGTCGGTCATCGAGGCGTTGCGCAAGGCCGGCGACCACACGCCGGTGCTGATCCTGTCGGCG
CTCGGCCAGGTCGACGACCGCGTCACCGGACTGCGGGCGGGCGGCGACGACTACCTGCCCAAGCCTTTCGCCTTCACCGA
GCTGCTGGCGCGGATCGAGGCACTCGGCCGGCGCCCGAAGGCGTCGGGAGAGACGGAGACGGTGTACCGGGTCGCCGACC
TGGAACTCGACCGCCTGACCCATCGCTGCAGCCGCGCCGGCAAGGACATTCCCCTGCAACCGCGCGAGTTCCGCCTGCTC
GAATACCTGATGCAGCATGCCGGGCAGGTGGTCACCCGCACCATGCTGCTGGAGAACGTCTGGGAGTATCACTTCGACCC
GCAGACCAACGTCATCGACGTCCACATCTCCCGCCTGCGCGCCAAGATCGACAAGGATTTCGACAGGCCGCTGCTGCACA
CGATCCGCGGCGCCGGATATTCGATCCGTGACGCCGCTGTCTAG

Protein sequence :
MRILIIEDDKQAAAYLAKGLREVGHVADHAADGEEGLERALDGDYDVMIVDRMLPRRDGLSVIEALRKAGDHTPVLILSA
LGQVDDRVTGLRAGGDDYLPKPFAFTELLARIEALGRRPKASGETETVYRVADLELDRLTHRCSRAGKDIPLQPREFRLL
EYLMQHAGQVVTRTMLLENVWEYHFDPQTNVIDVHISRLRAKIDKDFDRPLLHTIRGAGYSIRDAAV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-41 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-40 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ragA YP_004304628.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain BAC0125 Protein 2e-47 50
ragA YP_004304628.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain BAC0347 Protein 7e-48 49
ragA YP_004304628.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain BAC0083 Protein 1e-49 48
ragA YP_004304628.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain BAC0308 Protein 3e-47 48
ragA YP_004304628.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain BAC0197 Protein 6e-46 47
ragA YP_004304628.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain BAC0111 Protein 1e-52 47
ragA YP_004304628.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain BAC0638 Protein 3e-42 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ragA YP_004304628.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain VFG1389 Protein 2e-35 45
ragA YP_004304628.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain VFG0596 Protein 3e-41 44
ragA YP_004304628.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain VFG1390 Protein 4e-41 42
ragA YP_004304628.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain VFG0473 Protein 1e-28 41