Gene Information

Name : Clole_1230 (Clole_1230)
Accession : YP_004308156.1
Strain : Clostridium lentocellum DSM 5427
Genome accession: NC_015275
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1412024 - 1412605 bp
Length : 582 bp
Strand : +
Note : PFAM: Bacterial stress protein; KEGG: cdl:CDR20291_1532 tellurium resistance protein

DNA sequence :
ATGGGTATAACACTTGCAAAAGGACAAAAAGTAGATTTAACAAAATCTAATCCAGGACTTAAAAATATTATTGTTGGATT
AGGCTGGGACACCAATAAATATGATGGAGGGCAGTCATTTGATTTAGACACAGCAGCTTTTTTAACAGATGGTGCTGGTA
AAGTAACCTCTGATGCAGACTTTATTTTCTATAACAACTTACGTCATCCATCAGGTTCAGTAACTCATTTAGGTGATAAT
ACAACAGGAGCAGGAGACGGTGATGATGAGCAAATGAAAGTTCAGTTAGATACTGTGCCTGCTAACATTGAAAAAATTGC
TTTTACAGTAACCATTCATGAAGCAATGCAAAGAAATCAAAACTTTGGACAAGTATCTAATGCTTATATTCGTGTTTTAG
ATGAAACAGCAGGAACAGAGCTTATTCGTTACGACTTAGGGGAAGATTTCTCAATAGAAACAGCCATTGTTGTAGGTGAA
TTATATCGACATAATGGTGAGTGGAAGTTTAATGCAATTGGAAGTGGTTATCAAGGTGGTTTAGGTGCACTTTGCAATAA
CTTCGGTATTAATATTGGTTAA

Protein sequence :
MGITLAKGQKVDLTKSNPGLKNIIVGLGWDTNKYDGGQSFDLDTAAFLTDGAGKVTSDADFIFYNNLRHPSGSVTHLGDN
TTGAGDGDDEQMKVQLDTVPANIEKIAFTVTIHEAMQRNQNFGQVSNAYIRVLDETAGTELIRYDLGEDFSIETAIVVGE
LYRHNGEWKFNAIGSGYQGGLGALCNNFGINIG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-52 60
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-52 59
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-52 59
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-51 58
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-46 55
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-43 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-43 54
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-43 54
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-21 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-21 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Clole_1230 YP_004308156.1 stress protein BAC0389 Protein 4e-52 59
Clole_1230 YP_004308156.1 stress protein BAC0390 Protein 4e-47 55
Clole_1230 YP_004308156.1 stress protein BAC0392 Protein 4e-21 42