Gene Information

Name : Clole_1940 (Clole_1940)
Accession : YP_004308857.1
Strain : Clostridium lentocellum DSM 5427
Genome accession: NC_015275
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2144613 - 2145293 bp
Length : 681 bp
Strand : +
Note : KEGG: ere:EUBREC_2916 hypothetical protein; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver domain; Signal transduction response reg

DNA sequence :
ATGTTAAAGATACTTATAGTAGATGATGACACCAATATTTCCGAATTAATTGCTTTATACTTAAATAAAGAAGGATATGA
AACAAAAGAAGTGGCTACAGGTCGCTTAGCTTTAGAAGTGTTTGAATCTTTTTATCCAGACTTAGTACTGCTAGATGTCA
TGTTACCAGAACTAGATGGCTATGATGTTTGTAAAGAAATTCGTAAGCAGCATCGCACGCCGATTATTATGCTTACTGCT
AAAGGAGAGGTATTTGATAAGGTATTAGGCCTTGAGTTAGGGGCTGATGACTATATGGTAAAACCATTTGATCCTAAAGA
ACTTATAGCAAGAGTGAAAGCTGTCCTTAGACGTAATACGCAACCGATAGAGGAAGTTGCACCTAAAAATCGTATTGTGC
TTGATAATTTAATTATTGATAAGGATAATTATTCGGTGACTTATGAAGGAGCTTTAGTAGAATTACCACCAAAAGAACTA
GAGGTACTTTATTTTCTGGCAAGTCATCCTAAACAAGTTTTTACTAGAGAGCAGCTTTTAGATAAGATTTGGGGATATGA
CTTTGTAGGAGATACAAGAACTGTAGATGTGCATATTAAGAGGCTAAGAGATAAATTTGAGGGTGATCACACATGGAGCA
TAAAAACCGTCTGGGGCGTAGGCTACAAATTCGAGAGATAA

Protein sequence :
MLKILIVDDDTNISELIALYLNKEGYETKEVATGRLALEVFESFYPDLVLLDVMLPELDGYDVCKEIRKQHRTPIIMLTA
KGEVFDKVLGLELGADDYMVKPFDPKELIARVKAVLRRNTQPIEEVAPKNRIVLDNLIIDKDNYSVTYEGALVELPPKEL
EVLYFLASHPKQVFTREQLLDKIWGYDFVGDTRTVDVHIKRLRDKFEGDHTWSIKTVWGVGYKFER

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-29 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Clole_1940 YP_004308857.1 transcriptional regulator NC_012469.1.7685629. Protein 4e-45 51
Clole_1940 YP_004308857.1 transcriptional regulator NC_003923.1003749.p0 Protein 3e-42 50
Clole_1940 YP_004308857.1 transcriptional regulator NC_002758.1121668.p0 Protein 4e-42 50
Clole_1940 YP_004308857.1 transcriptional regulator NC_009641.5332272.p0 Protein 4e-42 50
Clole_1940 YP_004308857.1 transcriptional regulator NC_013450.8614421.p0 Protein 4e-42 50
Clole_1940 YP_004308857.1 transcriptional regulator NC_007793.3914279.p0 Protein 4e-42 50
Clole_1940 YP_004308857.1 transcriptional regulator NC_002745.1124361.p0 Protein 4e-42 50
Clole_1940 YP_004308857.1 transcriptional regulator NC_009782.5559369.p0 Protein 4e-42 50
Clole_1940 YP_004308857.1 transcriptional regulator NC_002951.3237708.p0 Protein 4e-42 50
Clole_1940 YP_004308857.1 transcriptional regulator NC_002952.2859905.p0 Protein 6e-42 49
Clole_1940 YP_004308857.1 transcriptional regulator NC_007622.3794472.p0 Protein 5e-42 49
Clole_1940 YP_004308857.1 transcriptional regulator HE999704.1.gene2815. Protein 1e-43 48
Clole_1940 YP_004308857.1 transcriptional regulator NC_012469.1.7686381. Protein 5e-41 47
Clole_1940 YP_004308857.1 transcriptional regulator AF155139.2.orf0.gene Protein 3e-39 46
Clole_1940 YP_004308857.1 transcriptional regulator AE015929.1.gene1106. Protein 2e-34 45
Clole_1940 YP_004308857.1 transcriptional regulator AE000516.2.gene3505. Protein 4e-38 45
Clole_1940 YP_004308857.1 transcriptional regulator NC_002951.3238224.p0 Protein 5e-39 44
Clole_1940 YP_004308857.1 transcriptional regulator NC_007793.3914065.p0 Protein 5e-39 44
Clole_1940 YP_004308857.1 transcriptional regulator NC_002758.1121390.p0 Protein 5e-39 44
Clole_1940 YP_004308857.1 transcriptional regulator NC_010079.5776364.p0 Protein 5e-39 44
Clole_1940 YP_004308857.1 transcriptional regulator NC_002952.2859858.p0 Protein 5e-39 44
Clole_1940 YP_004308857.1 transcriptional regulator NC_007622.3794948.p0 Protein 5e-39 44
Clole_1940 YP_004308857.1 transcriptional regulator NC_003923.1003417.p0 Protein 5e-39 44
Clole_1940 YP_004308857.1 transcriptional regulator NC_013450.8614146.p0 Protein 5e-39 44
Clole_1940 YP_004308857.1 transcriptional regulator DQ212986.1.gene4.p01 Protein 4e-35 44
Clole_1940 YP_004308857.1 transcriptional regulator FJ349556.1.orf0.gene Protein 1e-40 44
Clole_1940 YP_004308857.1 transcriptional regulator AM180355.1.gene1830. Protein 2e-36 43
Clole_1940 YP_004308857.1 transcriptional regulator CP000675.2.gene1535. Protein 2e-32 42
Clole_1940 YP_004308857.1 transcriptional regulator AE016830.1.gene1681. Protein 1e-40 42
Clole_1940 YP_004308857.1 transcriptional regulator NC_014475.1.orf0.gen Protein 5e-33 42
Clole_1940 YP_004308857.1 transcriptional regulator NC_005054.2598277.p0 Protein 5e-33 42
Clole_1940 YP_004308857.1 transcriptional regulator NC_002695.1.916589.p Protein 4e-32 42
Clole_1940 YP_004308857.1 transcriptional regulator BAC0039 Protein 5e-32 42
Clole_1940 YP_004308857.1 transcriptional regulator CP000034.1.gene2186. Protein 5e-32 42
Clole_1940 YP_004308857.1 transcriptional regulator NC_011595.7057856.p0 Protein 2e-32 41
Clole_1940 YP_004308857.1 transcriptional regulator NC_010400.5986590.p0 Protein 1e-32 41
Clole_1940 YP_004308857.1 transcriptional regulator NC_010410.6002989.p0 Protein 2e-32 41
Clole_1940 YP_004308857.1 transcriptional regulator HE999704.1.gene1528. Protein 4e-28 41
Clole_1940 YP_004308857.1 transcriptional regulator CP004022.1.gene1676. Protein 3e-31 41
Clole_1940 YP_004308857.1 transcriptional regulator CP001918.1.gene3444. Protein 5e-31 41
Clole_1940 YP_004308857.1 transcriptional regulator BAC0596 Protein 4e-31 41
Clole_1940 YP_004308857.1 transcriptional regulator CP000647.1.gene2531. Protein 3e-31 41
Clole_1940 YP_004308857.1 transcriptional regulator CP001138.1.gene2239. Protein 4e-31 41
Clole_1940 YP_004308857.1 transcriptional regulator CP001918.1.gene5135. Protein 2e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Clole_1940 YP_004308857.1 transcriptional regulator VFG1563 Protein 1e-29 41
Clole_1940 YP_004308857.1 transcriptional regulator VFG1702 Protein 3e-30 41