Gene Information

Name : Clole_3776 (Clole_3776)
Accession : YP_004310654.1
Strain : Clostridium lentocellum DSM 5427
Genome accession: NC_015275
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4129354 - 4130043 bp
Length : 690 bp
Strand : -
Note : KEGG: cst:CLOST_2557 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC); PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction respo

DNA sequence :
ATGCAACGTATTGGTATTATTGAAGATGAAAAAGCTATTTCGGACATTATTAAGTATAACCTAGAAAAGGACGGCTACGA
GGTATATACAGCCTATGATGGTGAAGAGGGTCTAAATCTTATCAAAACAAAGGATTTAGACCTAGTCCTACTAGATATTA
TGCTGCCTAAGAAAGATGGCCTAGAAATTTGTAAGGAAATTAGACAAACCAAAGAAGTGCCTATTATCATTATTTCTGCA
AAAGCAGATGAAATCGATAAAGTTTTAGCTTTAGAATTGGGTGCTGATGATTATGTCACAAAACCTTTTGGTATGAGAGA
GGTTATGGCAAGAGTAAAAGCAAGACTTAGAAGAAAAATGACAGAGGGAAATAAAGCAGAAGCTAACGAGGATAACTTAG
TAGAAGATAATTTGTGTATGGATCTTAAAAAGTATGAAGTAAGTAAAAATAATGAAGCTATTGATTTAACTCTTAGAGAA
TTTGAGCTTTTAAAATTCCTATGGCAAGCCAAAGGACAGGTGTTTTCTAGAGAAGAGTTATTAGAAAAGGTTTGGGGCTA
TGAGTATTATGGTGATGTAAGAACAGTAGATGTAACCATTAGAAGACTAAGAGAGAAAATAGAAGACGATGCCTCCAAAG
CAGCTTATGTATTAACCAAAAGAGGTGTAGGCTATTATTTTAGAGGCTAA

Protein sequence :
MQRIGIIEDEKAISDIIKYNLEKDGYEVYTAYDGEEGLNLIKTKDLDLVLLDIMLPKKDGLEICKEIRQTKEVPIIIISA
KADEIDKVLALELGADDYVTKPFGMREVMARVKARLRRKMTEGNKAEANEDNLVEDNLCMDLKKYEVSKNNEAIDLTLRE
FELLKFLWQAKGQVFSREELLEKVWGYEYYGDVRTVDVTIRRLREKIEDDASKAAYVLTKRGVGYYFRG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-38 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-38 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Clole_3776 YP_004310654.1 transcriptional regulator NC_012469.1.7685629. Protein 2e-59 56
Clole_3776 YP_004310654.1 transcriptional regulator NC_002952.2859905.p0 Protein 2e-50 48
Clole_3776 YP_004310654.1 transcriptional regulator NC_002745.1124361.p0 Protein 1e-50 48
Clole_3776 YP_004310654.1 transcriptional regulator NC_009782.5559369.p0 Protein 1e-50 48
Clole_3776 YP_004310654.1 transcriptional regulator NC_002951.3237708.p0 Protein 1e-50 48
Clole_3776 YP_004310654.1 transcriptional regulator NC_007622.3794472.p0 Protein 2e-50 48
Clole_3776 YP_004310654.1 transcriptional regulator NC_003923.1003749.p0 Protein 1e-50 48
Clole_3776 YP_004310654.1 transcriptional regulator NC_002758.1121668.p0 Protein 1e-50 48
Clole_3776 YP_004310654.1 transcriptional regulator NC_009641.5332272.p0 Protein 1e-50 48
Clole_3776 YP_004310654.1 transcriptional regulator NC_013450.8614421.p0 Protein 1e-50 48
Clole_3776 YP_004310654.1 transcriptional regulator NC_007793.3914279.p0 Protein 1e-50 48
Clole_3776 YP_004310654.1 transcriptional regulator HE999704.1.gene2815. Protein 3e-47 47
Clole_3776 YP_004310654.1 transcriptional regulator NC_012469.1.7686381. Protein 1e-42 46
Clole_3776 YP_004310654.1 transcriptional regulator AE016830.1.gene1681. Protein 7e-49 44
Clole_3776 YP_004310654.1 transcriptional regulator HE999704.1.gene1528. Protein 8e-35 42
Clole_3776 YP_004310654.1 transcriptional regulator AM180355.1.gene1830. Protein 2e-36 42
Clole_3776 YP_004310654.1 transcriptional regulator AF155139.2.orf0.gene Protein 3e-38 42
Clole_3776 YP_004310654.1 transcriptional regulator NC_013450.8614146.p0 Protein 6e-36 41
Clole_3776 YP_004310654.1 transcriptional regulator NC_002951.3238224.p0 Protein 6e-36 41
Clole_3776 YP_004310654.1 transcriptional regulator NC_007793.3914065.p0 Protein 6e-36 41
Clole_3776 YP_004310654.1 transcriptional regulator NC_002758.1121390.p0 Protein 6e-36 41
Clole_3776 YP_004310654.1 transcriptional regulator NC_010079.5776364.p0 Protein 6e-36 41
Clole_3776 YP_004310654.1 transcriptional regulator NC_002952.2859858.p0 Protein 6e-36 41
Clole_3776 YP_004310654.1 transcriptional regulator NC_007622.3794948.p0 Protein 6e-36 41
Clole_3776 YP_004310654.1 transcriptional regulator NC_003923.1003417.p0 Protein 6e-36 41
Clole_3776 YP_004310654.1 transcriptional regulator FJ349556.1.orf0.gene Protein 6e-39 41
Clole_3776 YP_004310654.1 transcriptional regulator NC_005054.2598277.p0 Protein 9e-39 41
Clole_3776 YP_004310654.1 transcriptional regulator NC_014475.1.orf0.gen Protein 9e-39 41
Clole_3776 YP_004310654.1 transcriptional regulator CP001918.1.gene3444. Protein 9e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Clole_3776 YP_004310654.1 transcriptional regulator VFG1563 Protein 9e-39 43
Clole_3776 YP_004310654.1 transcriptional regulator VFG1702 Protein 8e-39 43