Gene Information

Name : Clole_0645 (Clole_0645)
Accession : YP_004307577.1
Strain : Clostridium lentocellum DSM 5427
Genome accession: NC_015275
Putative virulence/resistance : Resistance
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 809471 - 810124 bp
Length : 654 bp
Strand : -
Note : KEGG: ccb:Clocel_0446 transcriptional regulator; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver domain; Signal transduction respons

DNA sequence :
TTGGCATCTATTTTAATTGTTGAAGATGAAGTGGCAATTAATGATCTTGTAAAACTAAACCTACATCTCGTGGGACACCA
ATGTACTTCTGTTTTTGAAGGAAAAAGTGCTATTTTTGCAATACAACGTGAGTCATATGATCTCATCATTTTAGATATCA
TGTTACCTGAACTTGATGGATTTGAAGTAATAAAGCAAGTAAATCAAACACCTACAATCTTTCTGACAGCAAAAAATAGT
CTTCAAAGCCGCATCCAAGGTTTCTCACTAGGAGCTGATGACTATATAACTAAACCTTTTGAAATGCTTGAATTACTCGC
CCGTGTAGAAGCTATTTTAAGACGGACTCAGAAAGCATCAAAATATTTCGAGATTCGAAATGTTAAAATCGATTTTGACA
GTCACCAGGTATTTTATAACGGACAATTAGTAGATTTCACTCCAAAGGAATATAATTTGCTAGAAGTACTCATAAACAAT
CGTAATATTGCACTCTCTAGAGAAAGGCTATTAGAACTGGTTTGGGGCTATGATTTTGAGGGAGACACTAGAACAGTAGA
TGTACATATACAAAAGCTTCGCAAAAAACTGAGCTGGGAAGGCGTAATAAAAACGGTATACAAGCTGGGATATCGCCTAG
AGGTGCGTCAATGA

Protein sequence :
MASILIVEDEVAINDLVKLNLHLVGHQCTSVFEGKSAIFAIQRESYDLIILDIMLPELDGFEVIKQVNQTPTIFLTAKNS
LQSRIQGFSLGADDYITKPFEMLELLARVEAILRRTQKASKYFEIRNVKIDFDSHQVFYNGQLVDFTPKEYNLLEVLINN
RNIALSRERLLELVWGYDFEGDTRTVDVHIQKLRKKLSWEGVIKTVYKLGYRLEVRQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 5e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Clole_0645 YP_004307577.1 transcriptional regulator NC_002952.2859905.p0 Protein 7e-35 43
Clole_0645 YP_004307577.1 transcriptional regulator NC_003923.1003749.p0 Protein 6e-35 43
Clole_0645 YP_004307577.1 transcriptional regulator NC_009641.5332272.p0 Protein 7e-35 43
Clole_0645 YP_004307577.1 transcriptional regulator NC_013450.8614421.p0 Protein 7e-35 43
Clole_0645 YP_004307577.1 transcriptional regulator NC_007622.3794472.p0 Protein 7e-35 43
Clole_0645 YP_004307577.1 transcriptional regulator NC_002745.1124361.p0 Protein 7e-35 43
Clole_0645 YP_004307577.1 transcriptional regulator NC_009782.5559369.p0 Protein 7e-35 43
Clole_0645 YP_004307577.1 transcriptional regulator NC_002951.3237708.p0 Protein 7e-35 43
Clole_0645 YP_004307577.1 transcriptional regulator NC_007793.3914279.p0 Protein 7e-35 43
Clole_0645 YP_004307577.1 transcriptional regulator NC_002758.1121668.p0 Protein 7e-35 43
Clole_0645 YP_004307577.1 transcriptional regulator NC_012469.1.7686381. Protein 9e-31 43
Clole_0645 YP_004307577.1 transcriptional regulator NC_013450.8614146.p0 Protein 3e-31 41
Clole_0645 YP_004307577.1 transcriptional regulator NC_002951.3238224.p0 Protein 3e-31 41
Clole_0645 YP_004307577.1 transcriptional regulator NC_007793.3914065.p0 Protein 3e-31 41
Clole_0645 YP_004307577.1 transcriptional regulator NC_002758.1121390.p0 Protein 3e-31 41
Clole_0645 YP_004307577.1 transcriptional regulator NC_010079.5776364.p0 Protein 3e-31 41
Clole_0645 YP_004307577.1 transcriptional regulator NC_002952.2859858.p0 Protein 3e-31 41
Clole_0645 YP_004307577.1 transcriptional regulator AE015929.1.gene1106. Protein 6e-28 41
Clole_0645 YP_004307577.1 transcriptional regulator NC_007622.3794948.p0 Protein 3e-31 41
Clole_0645 YP_004307577.1 transcriptional regulator NC_003923.1003417.p0 Protein 3e-31 41
Clole_0645 YP_004307577.1 transcriptional regulator AF310956.2.orf0.gene Protein 2e-32 41
Clole_0645 YP_004307577.1 transcriptional regulator FJ349556.1.orf0.gene Protein 4e-31 41
Clole_0645 YP_004307577.1 transcriptional regulator HE999704.1.gene2815. Protein 7e-34 41