Gene Information

Name : ermB (SOR_1880)
Accession : YP_004326867.1
Strain : Streptococcus oralis Uo5
Genome accession: NC_015291
Putative virulence/resistance : Resistance
Product : ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein
Function : -
COG functional category : J : Translation, ribosomal structure and biogenesis
COG ID : COG0030
EC number : -
Position : 1839657 - 1840394 bp
Length : 738 bp
Strand : +
Note : -

DNA sequence :
ATGAACAAAAATATAAAATATTCTCAAAACTTTTTAACGAGTGAAAAAGTACTCAACCAAATAATAAAACAATTGAATTT
AAAAGAAACCGATACCGTTTACGAAATTGGAACAGGTAAAGGGCATTTAACGACGAAACTGGCTAAAATAAGTAAACAGG
TAACGTCTATTGAATTAGACAGTCATCTATTCAACTTATCGTCAGAAAAATTAAAACTGAACATTCGTGTCACTTTAATT
CACCAAGATATTCTACAGTTTCAATTCCCTAACAAACAGAGGTATAAAATTGTTGGGAATATTCCTTACCATTTAAGCAC
ACAAATTATTAAAAAAGTGGTTTTTGAAAGCCATGCGTCTGACATCTATCTGATTGTTGAAGAAGGATTCTACAAGCGTA
CCTTGGATATTCACCGAACACTAGGGTTGCTCTTGCACACTCAAGTCTCGATTCAGCAATTGCTTAAGCTGCCAGCGGAA
TGCTTTCATCCTAAACCAAAAGTAAACAGTGTCTTAATAAAACTTACCCGCCATACCACAGATGTTCCAGATAAATATTG
GAAGCTATATACGTACTTTGTTTCAAAATGGGTCAATCGAGAATATCGTCAACTGTTTACTAAAAATCAGTTTCATCAAG
CAATGAAACACGCCAAAGTAAACAATTTAAGTACCGTTACTTATGAGCAAGTATTGTCTATTTTTAATAGTTATCTATTA
TTTAACGGGAGGAAATAA

Protein sequence :
MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDSHLFNLSSEKLKLNIRVTLI
HQDILQFQFPNKQRYKIVGNIPYHLSTQIIKKVVFESHASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAE
CFHPKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNNLSTVTYEQVLSIFNSYLL
FNGRK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ermA BAA82205.1 rRNA adenine N-6-methyltransferase Not tested Type-II SCCmec Protein 8e-54 52
ermA1 YP_039522.1 rRNA adenine N-6-methyltransferase 1 Not tested Type-II SCCmec Protein 1e-53 52
ermA NP_370576.1 rRNA methylase Not tested Type-II SCCmec Protein 1e-53 52
ermA NP_373288.1 rRNA methylase Not tested Type-II SCCmec Protein 1e-53 52
ermA-3 YP_190052.1 rRNA adenine N-6-methyltransferase Not tested Type-II SCCmec Protein 1e-53 52
unnamed BAB47663.1 rRNA adenine N-6-methyltransferase Not tested Type-III SCCmec Protein 2e-53 52
unnamed BAC53825.1 rRNA adenine N-6-methyltransferase Not tested SRImec-III and SCCmec-III region Protein 2e-53 52
ermA BAC57474.1 rRNA methylase Not tested Type-IIIinv SCCmec Protein 8e-54 52
ermC NP_273130.1 rRNA adenine N-6-methyltransferase Not tested IHT-A Protein 7e-57 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein AM903082.gene3.p01 Protein 1e-112 99
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein AM410044.gene14.p01 Protein 1e-112 99
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein AM180355.1.gene2254. Protein 7e-110 98
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein AM180355.1.gene2259. Protein 7e-110 98
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein NC_002745.1124324.p0 Protein 5e-54 52
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein NC_002745.1125313.p0 Protein 5e-54 52
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein AJ313523.1.orf0.gene Protein 9e-54 52
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein NC_009782.5559087.p0 Protein 5e-54 52
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein NC_002758.1121630.p0 Protein 5e-54 52
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein NC_002952.2859615.p0 Protein 5e-54 52
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein NC_002745.1123579.p0 Protein 5e-54 52
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein NC_002745.1124852.p0 Protein 5e-54 52
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein NC_009782.5559229.p0 Protein 5e-54 52
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein NC_002758.1120012.p0 Protein 5e-54 52
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein NC_002952.2859614.p0 Protein 5e-54 52
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein NC_002745.1122822.p0 Protein 5e-54 52
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein V01278.gene.p01 Protein 4e-58 52
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein M64090.gene.p01 Protein 5e-56 52
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein M15332.gene.p01 Protein 5e-53 51
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein NC_010686.6295746.p0 Protein 3e-57 51
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein NC_010685.6295744.p0 Protein 3e-57 51
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein NC_007209.3523503.p0 Protein 3e-57 50
ermB YP_004326867.1 ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein NC_007792.3912746.p0 Protein 1e-56 50