Gene Information

Name : Psed_3589 (Psed_3589)
Accession : YP_004333614.1
Strain : Pseudonocardia dioxanivorans CB1190
Genome accession: NC_015312
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 3843047 - 3843622 bp
Length : 576 bp
Strand : +
Note : PFAM: Bacterial stress protein; KEGG: fre:Franean1_1054 stress protein

DNA sequence :
GTGAGCGTCAGCCTCACCAAGGGTGGAAATGTCAGTCTGACCAAGGAGGCCCCGGGCCTCAGCAACGTCGTCGTCGGCCT
CGGGTGGGACGTGCGCACCACCACCGGCACCGAGTTCGACCTGGACGCCTCGGCGATCGCCGTGGGTGCCGACGGCAAGG
TCCTGTCGGACAAGCACTTCGTCTTCTTCAACAACCTCACGAGCCCCGACGGCGCCATCGAGCACACCGGCGACAACCTC
ACCGGCGAGGGCGAGGGCGACGACGAGCAGGTCAAGGTCAACCTGGCCGGGCTGGGCGCGGAGGTCGACAAGGTCGTCTT
CCCGGTCAGCATCTACGACGCCGACTCCCGCGCGCAGAGCTTCGGCCAGGTGCGCAACGCGTTCATCCGCGTCGTCAACG
CCGCCGACCAGAAGGAGCTCGCCCGCTACGACCTCACCGAGGACGCCTCGACCGAGACGGCGATGGTCTTCGGCGAGCTG
TACCGCAACGGGTCGGACTGGAAGTTCCGCGCGGTCGGCCAGGGCTACGCGTCGGGTCTCGCGGGCATCGCCCGCGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MSVSLTKGGNVSLTKEAPGLSNVVVGLGWDVRTTTGTEFDLDASAIAVGADGKVLSDKHFVFFNNLTSPDGAIEHTGDNL
TGEGEGDDEQVKVNLAGLGAEVDKVVFPVSIYDADSRAQSFGQVRNAFIRVVNAADQKELARYDLTEDASTETAMVFGEL
YRNGSDWKFRAVGQGYASGLAGIARDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-60 67
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-61 67
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-60 67
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-59 66
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-60 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-60 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-59 64
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-58 61
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-28 44
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-28 44
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-31 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psed_3589 YP_004333614.1 stress protein BAC0390 Protein 7e-61 65
Psed_3589 YP_004333614.1 stress protein BAC0389 Protein 1e-58 64
Psed_3589 YP_004333614.1 stress protein BAC0392 Protein 7e-28 43