Gene Information

Name : Psed_5028 (Psed_5028)
Accession : YP_004335019.1
Strain : Pseudonocardia dioxanivorans CB1190
Genome accession: NC_015312
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5379786 - 5380529 bp
Length : 744 bp
Strand : +
Note : KEGG: kra:Krad_3036 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver do

DNA sequence :
ATGACCGGGGTGAACGAGCAGGTCGCCGGCCGACTGCAGCGTGCCGACGGCAGTGCCGTGCGGGTGCTCGTCGTCGACGA
CGAGGCCACGCTGTCCGACCTGCTGGGAATGGCGTTGCGCTACGAGGGCTGGGACGTCCGCACCGAGGCCGACGGGGCCT
CGGCCGTGCGTGCGGCCCGCGAGTTCCGCCCCGACGCCGTCGTCCTCGACGTGATGCTGCCCGACCTCGACGGCCTGGAG
GTGCTGCGCCGCATGCGCGCCGACACCCCGGACGTCCCCGTGCTCTTCCTCACCGCGAAGGACGCCGTCGAGGACCGGGT
CGCGGGCCTGACCGCGGGCGGCGACGACTACGTGACCAAGCCGTTCAGCCTCGAGGAGCTGGTCGCCCGGCTGCGGGGGC
TGCTGCGCCGCTCCGGGATGACCGCCGCGCAGCAGGGCTCGGAGCTGGCCGTCGGCGACCTGACGCTCGACGAGGACAGC
CACGAGGTCCGCCGTGGCGACGTGGAGGTCGACCTCACGGCCACCGAGTTCGAGCTGCTGCGCTTCCTGATGCGCAACCC
GCGCCGCGTGCTCAGCAAGGCGCAGATCCTCGACCGCGTGTGGCACTACGACTTCGGCGGACAGTCCAACGTCGTCGAGC
TCTACATCTCCTACCTGCGCAAGAAGATCGACAACGGCCGGGCACCGATGATCCACACCGTCCGTGGCGCGGGCTACGTG
CTCAAGCCCGCGTCCGGGGAATGA

Protein sequence :
MTGVNEQVAGRLQRADGSAVRVLVVDDEATLSDLLGMALRYEGWDVRTEADGASAVRAAREFRPDAVVLDVMLPDLDGLE
VLRRMRADTPDVPVLFLTAKDAVEDRVAGLTAGGDDYVTKPFSLEELVARLRGLLRRSGMTAAQQGSELAVGDLTLDEDS
HEVRRGDVEVDLTATEFELLRFLMRNPRRVLSKAQILDRVWHYDFGGQSNVVELYISYLRKKIDNGRAPMIHTVRGAGYV
LKPASGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 9e-31 41
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 2e-31 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 2e-31 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 2e-31 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 2e-31 41
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 3e-21 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator BAC0083 Protein 4e-39 45
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-34 45
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-36 43
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-39 43
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-31 42
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-39 41
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-39 41
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-39 41
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-39 41
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-39 41
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-39 41
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-39 41
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-39 41
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 3e-34 41
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-33 41
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 6e-40 41
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator VFG1386 Protein 4e-63 55
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-48 51
Psed_5028 YP_004335019.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-52 49