Gene Information

Name : Psed_5141 (Psed_5141)
Accession : YP_004335131.1
Strain : Pseudonocardia dioxanivorans CB1190
Genome accession: NC_015312
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5504879 - 5505553 bp
Length : 675 bp
Strand : +
Note : KEGG: amd:AMED_6358 two-component system response regulator; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver domain; Signal transduc

DNA sequence :
GTGGCAGGACTGGTGCTGGTCGTCGAGGACGAGCCGGCGATCGCCGACCTCATCCGCCTCTACCTGCGCAAGGACGGATT
CGGTGTGCACGTCGAGCACGACGGCGCCGCGGGCCTCGACGCGGTCCGGCGGCTCGCCCCCGTCGCGGTCGTCCTCGACG
TCGGGCTGCCCGGCCTCGACGGCGTCGAGGTCTGCCGGCGGCTGCGCGCCGCCGACGACTGGACCCCCGTCCTGTTCGTC
ACCGCCCGCGACGACGAGGTCGACCGCATCCTGGGCCTGGAGATGGGCGCCGACGACTACGTCACCAAGCCGTTCAGCCC
GCGCGAGCTCGTCGCCAGGGTGCGGACGGTGCTGCGCCGCTCCGGCACCGGCGCCCCGCGCGAGGAGGTGCTGCGGGTGG
GCGAGGTCGAGGTGCAGGTCGACCGCCGGCGGGTGCGGGCCGGCACGACGGAGGTGGCGCTGACGGCGACGGAGTTCGCC
CTGCTCGCCCACCTCATGCGCGCGCCGGGCCGGGTGTACTCGCGCGACCAGCTGCTCTCGGCGGTCTGGGGCTACACGGC
GTCGTCGGGGGCGCGGACCGTCGACGTCCACGTCGCGCAGCTGCGGGCGAAGCTCGGGGACGCCAGCCCGATCCGGACGG
TGCGCGGCGTCGGGTACGCGGCGGACGCCCAGTGA

Protein sequence :
MAGLVLVVEDEPAIADLIRLYLRKDGFGVHVEHDGAAGLDAVRRLAPVAVVLDVGLPGLDGVEVCRRLRAADDWTPVLFV
TARDDEVDRILGLEMGADDYVTKPFSPRELVARVRTVLRRSGTGAPREEVLRVGEVEVQVDRRRVRAGTTEVALTATEFA
LLAHLMRAPGRVYSRDQLLSAVWGYTASSGARTVDVHVAQLRAKLGDASPIRTVRGVGYAADAQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 6e-18 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator BAC0197 Protein 6e-24 44
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-25 44
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator BAC0083 Protein 5e-27 44
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-30 44
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-37 43
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-18 43
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 2e-28 43
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator BAC0039 Protein 2e-28 43
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 1e-28 43
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 2e-28 43
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 1e-28 43
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 9e-37 42
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 8e-37 42
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 7e-37 42
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 7e-37 42
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 7e-37 42
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 7e-37 42
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 7e-37 42
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 7e-37 42
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 7e-37 42
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-36 42
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-35 41
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 1e-28 41
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator BAC0596 Protein 1e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-23 47
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-28 44
Psed_5141 YP_004335131.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-30 43