Gene Information

Name : Psed_5946 (Psed_5946)
Accession : YP_004335921.1
Strain : Pseudonocardia dioxanivorans CB1190
Genome accession: NC_015312
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 6302578 - 6303360 bp
Length : 783 bp
Strand : -
Note : KEGG: sen:SACE_3343 two-component response regulator; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver domain; Signal transduction re

DNA sequence :
GTGATCGGTAAGCACTTCGTCAGACCCGTCTTACCGACCGGTGACGAGGCCCCGACAGCCGGCACGCGCGGCGCTAGCGT
TGGCTTCGTGTGCGCACACGTCCTGGTCGTCGACGACGACGCGACCGTCCGCGACGTCGTCGCCCGTTACCTCGGGGCGG
CCGGGCACGACGTCGAGCTCGCCCTCGACGGACCGGGGGCGCTGCGGGCGGCACGGACGACCCCGCCCGACGTCGTCGTC
CTGGACCTCATGCTGCCCGGCCTCGGCGGCCTGGAGGTCTGCCGCGCGCTGCGCGCCGACGGTGACCGGCCCCCGATCAT
CATGCTCACCGCGCTGGGCGAGGAGGACGACCGGCTGCTCGGCCTGGAGCTGGGCGCCGACGACTACGTGACCAAGCCGT
TCAGTCCGCGCGAGCTCGTGCTGCGGGTGGGGTCGATCCTGCGCCGCACGGCCGCGCCCGCGACGGCGCCCGAGCTGGTC
GACGGCGGCCTGCGCGTCGACCCGGCCGCCCGGGTCGCGTCGCTGGACGGGCAGCCGCTGGCGCTGACGACCCGCGAGTT
CGACCTGCTCGCCTTCCTGCTCGCGCACCCCGGGCAGGCGTTCACCCGCGAGGAGCTGCTGTCCCGGGTGTGGGGCTGGG
AGTTCGGCGACCGCTCGACGGTCACCGTCCACGTGCGACGGCTGCGTGAGAAGGTCGAGGCCGACCCGACCGCGCCGCGT
CGGATCGCGACGATCTGGGGGACCGGGTACCGCTACGACCGCGGTACGACACCGGGAGGCTGA

Protein sequence :
MIGKHFVRPVLPTGDEAPTAGTRGASVGFVCAHVLVVDDDATVRDVVARYLGAAGHDVELALDGPGALRAARTTPPDVVV
LDLMLPGLGGLEVCRALRADGDRPPIIMLTALGEEDDRLLGLELGADDYVTKPFSPRELVLRVGSILRRTAAPATAPELV
DGGLRVDPAARVASLDGQPLALTTREFDLLAFLLAHPGQAFTREELLSRVWGWEFGDRSTVTVHVRRLREKVEADPTAPR
RIATIWGTGYRYDRGTTPGG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-29 45
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-21 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 4e-23 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-20 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 2e-21 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 2e-21 41
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 2e-21 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 2e-21 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-28 48
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-32 47
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-34 46
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 7e-36 45
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 2e-23 45
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 3e-23 45
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-35 44
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 2e-23 44
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 2e-23 44
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator BAC0596 Protein 1e-23 44
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator BAC0039 Protein 2e-23 44
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 1e-23 44
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-35 43
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-35 43
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-35 43
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-35 43
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-35 43
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-35 43
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-35 43
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-35 43
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-35 43
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 2e-23 41
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 2e-23 41
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 1e-27 41
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 1e-27 41
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 1e-27 41
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 5e-18 41
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator BAC0111 Protein 7e-26 41
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator BAC0197 Protein 5e-18 41
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator U82965.2.orf14.gene. Protein 2e-13 41
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator NC_008702.1.4607594. Protein 2e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-29 45
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator VFG1390 Protein 9e-27 43
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-25 43
Psed_5946 YP_004335921.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-21 42