Gene Information

Name : Fluta_3889 (Fluta_3889)
Accession : YP_004346691.1
Strain : Fluviicola taffensis DSM 16823
Genome accession: NC_015321
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4412740 - 4413423 bp
Length : 684 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: zpr:ZPR_0969 two-component system response regulator; PFAM: Signal transduction response regulator, rece

DNA sequence :
GTGAAAAAAATATTGATAATCGAAGATGATCCACAAATTAGCTCCATTGTTCAGAAAGGATTAACTGAAGAGAACTTTGA
AACTAAAACGGCAAACAATGGATTAAAGGGGTTAGATGAATTTCATTTTTGGAAGCCTGATTTGATTATTTTGGATATTA
TGCTTCCAGGACTGAATGGTATTCAAGTTTGCTCAAAAATTAGAGAGACAAGTCAAGTTCCGATTTTGATGTTAACCGCA
TTAGGTACTCCAGAAAATGTGGCTTTAGGATTAGATTCTGGAGCGGATGACTATTTGCCTAAACCATTCAAATTTATCGA
ATTAAATGCCCGCGTGCGCTCTTTGTTGCGTCGAATTGAAAATCAAGTAACTGCTTCAAGCACCCTATTTTCATTTTCAG
ATTTGGTGATTGATGATGATCGAAAAACAGTTATTCGCAATGGACATTTGATCACACTTACTTCCACAGAATATCGTTTG
TTATTATTATTTATGATGAGTCCTAAAAAGGTTTTTTCGCGGATAGATATTTTAGAAGAGGTTTGGGGAATTGATTTTGA
ATCTGGAACAAATGTGGTAGACGTTTATGTTAACTATTTACGTAAGAAGTTGATGCAATTTGGAGATTCTAAACTAATCC
ATACGGTAATAGGAATGGGATATGTAATGCGTGAAGAAGAATGA

Protein sequence :
MKKILIIEDDPQISSIVQKGLTEENFETKTANNGLKGLDEFHFWKPDLIILDIMLPGLNGIQVCSKIRETSQVPILMLTA
LGTPENVALGLDSGADDYLPKPFKFIELNARVRSLLRRIENQVTASSTLFSFSDLVIDDDRKTVIRNGHLITLTSTEYRL
LLLFMMSPKKVFSRIDILEEVWGIDFESGTNVVDVYVNYLRKKLMQFGDSKLIHTVIGMGYVMREEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-33 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-33 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-36 46
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-38 45
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-36 45
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-36 44
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-30 44
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-36 44
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-39 43
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-39 43
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-39 43
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-39 43
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-39 43
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-39 43
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-39 43
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-39 43
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator BAC0197 Protein 5e-38 43
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-29 42
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-34 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-33 44
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-47 44
Fluta_3889 YP_004346691.1 winged helix family two component transcriptional regulator VFG1389 Protein 4e-34 41