Gene Information

Name : bgla_2g14630 (bgla_2g14630)
Accession : YP_004349421.1
Strain :
Genome accession: NC_015376
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1832594 - 1833289 bp
Length : 696 bp
Strand : -
Note : -

DNA sequence :
ATGAAAGTATTGATCGTCGAAGACGAACCGAAGGTCGTCGATTACCTGAAGAGCGGGCTGTCGGAGGAAGGCTGGGTGGT
CGACACCGCCACCGACGGCGAGGACGGCGCCTGGAAGGCCGTCGAATACGACTACGACGTGGTCGTGCTGGACGTGATGC
TGCCGAAGATCGACGGCTTCGGCGTGTTGCGCGCGCTGCGCGCGCAGAAGGACACGCCGGTCATCATGCTGACCGCGCGC
GACCGCGTCGACGACCGCGTGCGCGGCCTGCGCGGCGGCGCCGACGACTACCTGACCAAGCCCTTCTCCTTCCTCGAGCT
GATCGAGCGGCTGCGCGCGCTGACGCGCCGCGCGCGCGTGCAGGAATCGACGCTGATCTCGATCGGCGACCTGCGGGTCG
ACCTGATCAGCCGCCGCGCCACCCGCAACGGCATCCGCCTGGACCTGACCGCCCAGGAATTCCAACTGCTCGGCGTGCTG
GCGCGCCGGCGCGGCGAGGTGCTGTCGAAGACCACCATCACCGAGCTGGTCTGGGACGTCAATTTCGACAGCAACGCCAA
CGTGGTGGAAACCGCCATCAAGCGTCTGCGGGCCAAGCTCGACGGCCCGTTCTCCGACAAACTGCTGCATACCATCCGCG
GGATGGGATACGTGCTCGAGGTCCGCGACGAGCCCGAACCCGACCTGCGCCGCTGA

Protein sequence :
MKVLIVEDEPKVVDYLKSGLSEEGWVVDTATDGEDGAWKAVEYDYDVVVLDVMLPKIDGFGVLRALRAQKDTPVIMLTAR
DRVDDRVRGLRGGADDYLTKPFSFLELIERLRALTRRARVQESTLISIGDLRVDLISRRATRNGIRLDLTAQEFQLLGVL
ARRRGEVLSKTTITELVWDVNFDSNANVVETAIKRLRAKLDGPFSDKLLHTIRGMGYVLEVRDEPEPDLRR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-35 51
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-34 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bgla_2g14630 YP_004349421.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0083 Protein 3e-42 57
bgla_2g14630 YP_004349421.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0125 Protein 3e-47 57
bgla_2g14630 YP_004349421.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0197 Protein 3e-43 54
bgla_2g14630 YP_004349421.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0638 Protein 1e-33 54
bgla_2g14630 YP_004349421.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0111 Protein 7e-42 50
bgla_2g14630 YP_004349421.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0308 Protein 2e-41 50
bgla_2g14630 YP_004349421.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0347 Protein 5e-37 47
bgla_2g14630 YP_004349421.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_013450.8614146.p0 Protein 5e-26 41
bgla_2g14630 YP_004349421.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_002951.3238224.p0 Protein 5e-26 41
bgla_2g14630 YP_004349421.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_007793.3914065.p0 Protein 5e-26 41
bgla_2g14630 YP_004349421.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_002758.1121390.p0 Protein 5e-26 41
bgla_2g14630 YP_004349421.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_010079.5776364.p0 Protein 5e-26 41
bgla_2g14630 YP_004349421.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_002952.2859858.p0 Protein 5e-26 41
bgla_2g14630 YP_004349421.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_007622.3794948.p0 Protein 5e-26 41
bgla_2g14630 YP_004349421.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_003923.1003417.p0 Protein 5e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bgla_2g14630 YP_004349421.1 two component heavy metal response transcriptional regulator, winged helix family protein VFG0596 Protein 6e-36 51
bgla_2g14630 YP_004349421.1 two component heavy metal response transcriptional regulator, winged helix family protein VFG1389 Protein 2e-28 48
bgla_2g14630 YP_004349421.1 two component heavy metal response transcriptional regulator, winged helix family protein VFG1386 Protein 4e-24 43