Gene Information

Name : bgla_4p1150 (bgla_4p1150)
Accession : YP_004362737.1
Strain :
Genome accession: NC_015383
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 103805 - 104149 bp
Length : 345 bp
Strand : +
Note : -

DNA sequence :
GTGATCTCGCTGCCGGCAGGTACGCGTATCTGGCTGGCGGCCGGCGTGACCGATATGCGCTGCGGGTTCCAGGGCCTGGC
CGCGAAGGTGCAGACGGCGCTCGAAGAGAATCCTCTGGGCGGCCACGTGTTCATCTTCCGCGGCCGTCGCGGCGATCTCG
TGAAACTGCTTTGGGCGACCGACGACGGACTCTGGCTGCTCGCAAAGCGATTGGAGCGAGGCCGGTTTATTTGGCCCCAG
GCCGACGGCGGAAAGGTCCATCTGACGAGCGCTCAACTGTCGATGCTGCTCGAGGGCATCGATTGGCGGCAGCCACGCCG
CACCGCCACTCTGTCGATGTTGTAA

Protein sequence :
MISLPAGTRIWLAAGVTDMRCGFQGLAAKVQTALEENPLGGHVFIFRGRRGDLVKLLWATDDGLWLLAKRLERGRFIWPQ
ADGGKVHLTSAQLSMLLEGIDWRQPRRTATLSML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-27 74
unnamed AAC31493.1 L0014 Not tested LEE Protein 5e-36 73
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 5e-36 73
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 3e-35 73
unnamed AAL99258.1 unknown Not tested LEE Protein 5e-36 73
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 3e-35 73
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 5e-36 73
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 7e-36 73
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 7e-36 73
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 7e-36 73
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 7e-36 73
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 3e-32 73
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-36 72
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-36 72
unnamed AAL08461.1 unknown Not tested SRL Protein 1e-35 71
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 7e-36 70
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 7e-36 70
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-35 69
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 3e-36 68
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 3e-36 68
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-32 63
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 4e-31 63
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 4e-31 63
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-32 63
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-32 61

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bgla_4p1150 YP_004362737.1 IS66 Orf2 family protein VFG1517 Protein 8e-28 74
bgla_4p1150 YP_004362737.1 IS66 Orf2 family protein VFG0792 Protein 2e-36 73
bgla_4p1150 YP_004362737.1 IS66 Orf2 family protein VFG1709 Protein 2e-36 73
bgla_4p1150 YP_004362737.1 IS66 Orf2 family protein VFG1698 Protein 2e-36 72
bgla_4p1150 YP_004362737.1 IS66 Orf2 family protein VFG1052 Protein 4e-36 71
bgla_4p1150 YP_004362737.1 IS66 Orf2 family protein VFG1665 Protein 6e-36 69
bgla_4p1150 YP_004362737.1 IS66 Orf2 family protein VFG1737 Protein 2e-32 61