Gene Information

Name : bgla_4p1740 (bgla_4p1740)
Accession : YP_004362784.1
Strain :
Genome accession: NC_015383
Putative virulence/resistance : Unknown
Product : putative transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 164816 - 165163 bp
Length : 348 bp
Strand : -
Note : -

DNA sequence :
GTGATCGGCCTACCTCAGAACGCTCGAATCTGGATCGCGGCCGGCACGACGGACATGCGCTGCGGCTTCAACTCGCTCGC
GGCGAAGGTGCAGACCGTGCTGGAGAAGGATCCGTTCTCCGGTCGTGTGTTCGTGTTCCGCGGCAAGCGTGGTGACTTGC
TGAAGTGTTTGTACTGGAGCGACGGCGGGCTATGTCTGCTGGCGAAGCGGCTCGAGAAGGGACGTTTCGCCTGGCCGCGT
GCCGATGCCGGCGTGGTCGCGCTGACGACCGCCCAACTCTCGCTCCTGCTCGAGGGATTCGATTGGCGGCAGCCGATCGA
CGCCGCGCGCCCGCGCAGCGCGTTGTAA

Protein sequence :
MIGLPQNARIWIAAGTTDMRCGFNSLAAKVQTVLEKDPFSGRVFVFRGKRGDLLKCLYWSDGGLCLLAKRLEKGRFAWPR
ADAGVVALTTAQLSLLLEGFDWRQPIDAARPRSAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 9e-48 94
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-28 67
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-28 67
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-28 67
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-28 67
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-28 67
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-28 67
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-28 67
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-28 67
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-27 67
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-27 67
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-28 67
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-28 67
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 6e-21 65
unnamed AAL08461.1 unknown Not tested SRL Protein 5e-28 65
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 4e-30 61
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 4e-30 61
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 5e-30 60
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 4e-30 60
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 4e-30 60
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 5e-27 56
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 5e-27 56
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-25 55
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-25 55
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-27 54

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bgla_4p1740 YP_004362784.1 putative transposase VFG0792 Protein 8e-29 67
bgla_4p1740 YP_004362784.1 putative transposase VFG1698 Protein 7e-29 67
bgla_4p1740 YP_004362784.1 putative transposase VFG1709 Protein 8e-29 67
bgla_4p1740 YP_004362784.1 putative transposase VFG1517 Protein 2e-21 65
bgla_4p1740 YP_004362784.1 putative transposase VFG1052 Protein 2e-28 65
bgla_4p1740 YP_004362784.1 putative transposase VFG1665 Protein 2e-30 60
bgla_4p1740 YP_004362784.1 putative transposase VFG1737 Protein 2e-27 54