Gene Information

Name : Marky_1676 (Marky_1676)
Accession : YP_004368521.1
Strain : Marinithermus hydrothermalis DSM 14884
Genome accession: NC_015387
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1695773 - 1696447 bp
Length : 675 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: opr:Ocepr_1581 two component transcriptional regulator, winged helix family; PFAM: Signal transduction r

DNA sequence :
ATGGACAGCCCACTGGTCTTGATCGTCGAGGACGAAAAAGACATCGCTCGCTTTATCGAGCTCGAGCTTCAGGCCGAAGG
GTACCGCACGGAAGTCGCGTACGACGGGATTACGGGCCTTTCCAAGTTCCGAGAAACCTCACCCAACCTGGTCATCCTAG
ACCTCATGCTCCCCGTGATGGACGGCCTCGAGGTCGCGCGGCGCATCCGCAAGACCTCGAACGTGCCGATCCTGATCCTG
ACCGCCAAGGACGCGGTGACGGACAAGGTGGAGGGCTTGGACGCCGGGGCGGACGACTACCTGGTCAAGCCCTTCTCCAT
CGAGGAGCTCCTGGCCCGGGTGCGGGCGCACCTGCGCCGGGTCACGCCCGCGATCACCGGGGAGATCCGCGTGGCCGATC
TGATCATCAACCTGGAGGGGCGCGAGGTCTTCCGCGGCGGGCGCCGCATCGAGCTGTCCAACAAGGAGTTCGAGCTTTTG
GAGCTCCTGGCCCGCAGTCCCGGCAAGGTCTTCAGCCGCTTCGAGATCGAGGAGAAGGTCTGGCCGGGCTACCAGGGGGG
CTCGAACGTGGTGGACGTGTACATCGGGTACCTGCGTAAGAAACTCGAGGCGGGGGGGGAGCGGCGCCTGATCCACACCG
TGCGCGGGGTGGGGTACGTGCTGCGGGAGGATTGA

Protein sequence :
MDSPLVLIVEDEKDIARFIELELQAEGYRTEVAYDGITGLSKFRETSPNLVILDLMLPVMDGLEVARRIRKTSNVPILIL
TAKDAVTDKVEGLDAGADDYLVKPFSIEELLARVRAHLRRVTPAITGEIRVADLIINLEGREVFRGGRRIELSNKEFELL
ELLARSPGKVFSRFEIEEKVWPGYQGGSNVVDVYIGYLRKKLEAGGERRLIHTVRGVGYVLRED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-31 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-27 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-27 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-31 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-38 51
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-38 51
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-38 51
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-38 51
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-38 51
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-38 51
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-38 51
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-38 51
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 3e-39 50
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family BAC0125 Protein 6e-40 50
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 4e-34 46
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-31 46
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family BAC0197 Protein 3e-33 45
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 3e-33 45
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family BAC0308 Protein 4e-36 44
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family BAC0083 Protein 3e-35 43
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family BAC0111 Protein 6e-34 43
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family BAC0638 Protein 4e-27 43
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 8e-32 42
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family BAC0347 Protein 6e-29 42
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 6e-32 42
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 9e-32 42
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 9e-32 42
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 9e-32 42
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 9e-32 42
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 9e-32 42
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-31 42
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 6e-32 42
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 9e-32 42
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 9e-32 42
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 5e-30 41
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family U82965.2.orf14.gene. Protein 3e-18 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family VFG1390 Protein 4e-45 50
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family VFG1386 Protein 5e-36 44
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family VFG1389 Protein 3e-35 44
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family VFG0596 Protein 7e-32 43
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family VFG1563 Protein 6e-28 42
Marky_1676 YP_004368521.1 two component transcriptional regulator, winged helix family VFG1702 Protein 7e-28 42