Gene Information

Name : Corgl_0039 (Corgl_0039)
Accession : YP_004371983.1
Strain : Coriobacterium glomerans PW2
Genome accession: NC_015389
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 43405 - 44133 bp
Length : 729 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: apv:Apar_1349 two component transcriptional regulator, winged helix family; PFAM: response regulator rec

DNA sequence :
ATGGCTTCGGATGCGAGAAAAATTCTGCTGGTCGAAGACGAGAAGGCTATCCGCGACGCCGTCGCAGCCTATCTCGAGCG
CGAAGGTTACTGGGTCGTCGGTGTCGGGGACGGCCAATCTGCGGTCGAGGAGTTCGAAAAGCATCAGTTCGATCTGATCG
TACTCGACCTCATGCTGCCCAAGCTCTCAGGCGAGCGCGTCTGCCGTGCCATTCGCGACACCTCGGATGTACCCATCATC
ATGCTGACCGCCAAAGGCGAGGTGGAGGATCGCATCATCGGTCTTGAACTCGGCGCCGACGATTACATCATCAAGCCGTT
CTCGCCTCGCGAGCTCGTCGCGAGGGTTCGCGCGCTGTTTCGGCGCACTCATCTGGCCGACGAGCCCCAAGTCGAGGTGC
TCGATTTCGGGGATCTGGTCATCGATATCTCCGGGCACAAGATCTTGGTGGAGGGCAACGAGGTTGATCTCACCGCCTCC
GAGTTCAAGCTTCTGACCACGCTCGCGCGCCATCCCGGGCGCGTCTACAACCGCATGGAGCTGGTCGAGAAGGTTTTGGG
GTACGACTTCGAGGGCTATGAGCGCACGATCGACTCGCACGTCAAGAACCTCCGCGCCAAGCTCGGCGATGATCCCAAGA
AGCCCAAATGGCTCTACACGGTCCACGGAGTGGGTTACCGCTTCGAGGCTCCGGCCCAGCCGGCGGCGAAGGCTGACGAG
AGCGAGTAG

Protein sequence :
MASDARKILLVEDEKAIRDAVAAYLEREGYWVVGVGDGQSAVEEFEKHQFDLIVLDLMLPKLSGERVCRAIRDTSDVPII
MLTAKGEVEDRIIGLELGADDYIIKPFSPRELVARVRALFRRTHLADEPQVEVLDFGDLVIDISGHKILVEGNEVDLTAS
EFKLLTTLARHPGRVYNRMELVEKVLGYDFEGYERTIDSHVKNLRAKLGDDPKKPKWLYTVHGVGYRFEAPAQPAAKADE
SE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-40 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-40 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-41 48
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 2e-34 45
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family CP000675.2.gene1535. Protein 9e-45 44
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-40 44
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-40 44
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-40 44
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-40 44
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-40 44
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-40 44
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-40 44
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-40 44
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-40 44
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-40 44
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 3e-39 44
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 3e-39 44
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 8e-42 43
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 1e-32 43
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 2e-38 43
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 6e-43 42
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 5e-43 42
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 6e-43 42
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 3e-35 42
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 3e-35 42
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 1e-34 42
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 9e-33 42
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family BAC0039 Protein 3e-35 42
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 3e-35 42
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family BAC0596 Protein 1e-34 42
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 4e-39 42
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 6e-35 42
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 6e-35 42
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 1e-30 42
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 6e-35 41
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family AF130997.1.orf0.gene Protein 7e-32 41
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 4e-33 41
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 4e-33 41
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 4e-34 41
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family CP000034.1.gene3671. Protein 6e-39 41
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family NC_008702.1.4607594. Protein 4e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family VFG1389 Protein 8e-31 43
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family VFG1702 Protein 6e-41 42
Corgl_0039 YP_004371983.1 two component transcriptional regulator, winged helix family VFG1563 Protein 2e-40 41