Gene Information

Name : Alide2_1769 (Alide2_1769)
Accession : YP_004387672.1
Strain : Alicycliphilus denitrificans K601
Genome accession: NC_015422
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1866286 - 1866969 bp
Length : 684 bp
Strand : +
Note : KEGG: gbm:Gbem_2672 winged-helix transcriptional response regulator; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver domain; Signal

DNA sequence :
ATGCGCATCCTGATCATCGAAGACCAGTCGAAAGTCGCCCAGTCCGTCAAGCACGGGCTGGAGGCCGAGCGCTTCGACGT
GACGGTGGCGGCCACCGGGGAGGACGGCTTCTTTCTCGTCTCGTCGCAGGTGTTCGACCTGCTCATCCTCGATCTCATGC
TGCCCGGCCGCGACGGCCTGGAGATCCTGCGCACCTTGCGCAGCCGGGGGCTGGCCACGCCGGTGATCATCCTCTCGGCG
CGGGACACGGTGGGGGACCGCATCCGCGGCCTTGACCTCGGTGCCGACGACTACCTCGTCAAGCCCTTCGCCTTCGAGGA
GCTGCTGGCACGCATCCGGGCGCTGCTGCGGCGCGGGCGGGCCCAGGACGTGCTGCGCCTCAAAGTGGCGGACCTGGAGG
TGGACCGGGTCACGCGCCGGGTGGCGCGCGGCGGGCAGGACGTGGAACTCACCGCGCACGAATACGAACTGCTCGACTAT
CTGCTGCTGCACCAGGGCCGCGTGGTGTCGCGCGAGATGCTCGCGCGCGACGTCTGGCGCGAAGTGGCGCGCGCCACGCC
GCTCGACAATGTCATCGACGTGCACATCGCCCGGCTGCGGCGCAAGATCGACAATGGTCACGGACATCCGCTGATCCACA
CGGTGCGCGGGGTCGGTTTCGTGCTTCAGGAGCAGGCGCCGTGA

Protein sequence :
MRILIIEDQSKVAQSVKHGLEAERFDVTVAATGEDGFFLVSSQVFDLLILDLMLPGRDGLEILRTLRSRGLATPVIILSA
RDTVGDRIRGLDLGADDYLVKPFAFEELLARIRALLRRGRAQDVLRLKVADLEVDRVTRRVARGGQDVELTAHEYELLDY
LLLHQGRVVSREMLARDVWREVARATPLDNVIDVHIARLRRKIDNGHGHPLIHTVRGVGFVLQEQAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-32 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator BAC0125 Protein 7e-38 48
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator BAC0083 Protein 4e-35 48
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-33 47
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator BAC0111 Protein 4e-34 47
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-34 46
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-32 46
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-34 44
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-25 42
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-25 42
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-25 42
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-25 42
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-25 42
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-25 42
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-25 42
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-25 42
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 8e-20 41
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 3e-22 41
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 2e-18 41
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 2e-18 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-30 44
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-21 43
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator VFG0473 Protein 8e-25 42
Alide2_1769 YP_004387672.1 winged helix family two component transcriptional regulator VFG0596 Protein 5e-33 41