Gene Information

Name : Alide2_1821 (Alide2_1821)
Accession : YP_004387722.1
Strain : Alicycliphilus denitrificans K601
Genome accession: NC_015422
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1923466 - 1923909 bp
Length : 444 bp
Strand : +
Note : TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional regulator; PFAM: Transcription regulator MerR, DNA binding; HTH transcriptional regulator, MerR; KEGG: tgr:Tgr7_2809 putative transcriptional regulator, MerR family; SMART: HTH transcriptional regulator, M

DNA sequence :
ATGGAAATCAGGATCGGCGAACTGGCGCAGCGCACGGGATGCGAGGTCGTGACCATTCGTTACTACGAAAAGGAAGGGCT
ATTGCCTGAGCCGGCGCGAAGCAGCGGGAACTATCGGCTGTACGGCGAGGAGCAAGTCAAGCGCATGCAGTTCATTCGCC
ACTGCCGTTCGCTGGACATGTCGCTGGGCGAGATTCGGACCTTACTGAACCTGTGGGACAGCCCCACCCAGGATTGCGGA
AAAGTGAATGCCCTGCTGGATGACCATATCCGGCAGGTGGAGGCGCGGGTCGAGGCGTTGTTGCAGCTAAGGCTGCATTT
GACGGCCTTGCGTGAAAAGTGCGCCGGCGCACGACCCGTCGAGGCGTGCGGCATTCTTCAAGGGCTCGTGAATTGTTCTT
GCCATACCGTCAGCACCCGAGACGAGGCCAGCGCTGGCGTTTAG

Protein sequence :
MEIRIGELAQRTGCEVVTIRYYEKEGLLPEPARSSGNYRLYGEEQVKRMQFIRHCRSLDMSLGEIRTLLNLWDSPTQDCG
KVNALLDDHIRQVEARVEALLQLRLHLTALREKCAGARPVEACGILQGLVNCSCHTVSTRDEASAGV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 3e-29 54
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 2e-27 51
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 1e-27 51
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 9e-28 51
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 9e-28 51
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 4e-27 50
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 3e-27 50
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 2e-27 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alide2_1821 YP_004387722.1 MerR family transcriptional regulator BAC0301 Protein 2e-34 61
Alide2_1821 YP_004387722.1 MerR family transcriptional regulator BAC0058 Protein 2e-32 52