
|
Name : Alide2_1830 (Alide2_1830) Accession : YP_004387729.1 Strain : Alicycliphilus denitrificans K601 Genome accession: NC_015422 Putative virulence/resistance : Unknown Product : transposase IS3/IS911 family protein Function : - COG functional category : L : Replication, recombination and repair COG ID : COG2963 EC number : - Position : 1935553 - 1935846 bp Length : 294 bp Strand : + Note : PFAM: Transposase IS3/IS911family; KEGG: rpi:Rpic_2066 transposase IS3/IS911 family protein DNA sequence : ATGGAGAGAAGAAGGACATTCAGCCGCGAGTTCAAGCTCGAGGCGGTCAGGTTGGTCACCGAGCGTGGCGTGGCTGTGGC CCAGGCAGCCAAGGACCTGGACGTTCACGAGAACGTGCTGCGCAAGTGGGTTCGTGAGTTGCGAGAGGAGCCCCAGGAGG CGTTCCCTGGCAACGGCAAGCAGAAGGCCCAGGACGCGGAGATAGCGCGACTGCGCAAGGAGGTTGCCAAGCTCAAGATG GAGCGCGACATCCTGAAAAAAGCCGCGGCCTACTTCGCGAAGGAGTCGATGTGA Protein sequence : MERRRTFSREFKLEAVRLVTERGVAVAQAAKDLDVHENVLRKWVRELREEPQEAFPGNGKQKAQDAEIARLRKEVAKLKM ERDILKKAAAYFAKESM |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| hp2 | AAC61714.1 | Hp2 | Not tested | PAI I CFT073 | Protein | 5e-12 | 42 |
| unnamed | AAF09021.1 | unknown | Not tested | SHI-O | Protein | 5e-12 | 42 |
| unnamed | AAF09029.1 | unknown | Not tested | SHI-O | Protein | 5e-12 | 42 |
| tnpJ | AAD44752.1 | TnpJ | Not tested | SHI-2 | Protein | 5e-12 | 42 |
| unnamed | AAQ07469.1 | TnpJ-like protein | Not tested | Not named | Protein | 5e-12 | 42 |
| c3576 | NP_755451.1 | hypothetical protein | Not tested | PAI I CFT073 | Protein | 7e-12 | 42 |
| orfA | ACX47959.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-13 | 42 |
| VC1790 | NP_231425.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 1e-13 | 42 |
| VPI2_0009c | ACA01826.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 1e-13 | 42 |
| orfA | YP_001217330.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 1e-13 | 42 |
| orfA | AGK06911.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-13 | 42 |
| unnamed | AGK06948.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-13 | 42 |
| orfA | AGK06994.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-13 | 42 |
| orfA | AGK07052.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-13 | 42 |
| EXB21 | ABD94708.1 | putative transposase | Not tested | ExoU island B | Protein | 6e-08 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Alide2_1830 | YP_004387729.1 | transposase IS3/IS911 family protein | VFG1707 | Protein | 2e-12 | 42 |
| Alide2_1830 | YP_004387729.1 | transposase IS3/IS911 family protein | VFG1123 | Protein | 4e-14 | 42 |