Gene Information

Name : Alide2_1830 (Alide2_1830)
Accession : YP_004387729.1
Strain : Alicycliphilus denitrificans K601
Genome accession: NC_015422
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 1935553 - 1935846 bp
Length : 294 bp
Strand : +
Note : PFAM: Transposase IS3/IS911family; KEGG: rpi:Rpic_2066 transposase IS3/IS911 family protein

DNA sequence :
ATGGAGAGAAGAAGGACATTCAGCCGCGAGTTCAAGCTCGAGGCGGTCAGGTTGGTCACCGAGCGTGGCGTGGCTGTGGC
CCAGGCAGCCAAGGACCTGGACGTTCACGAGAACGTGCTGCGCAAGTGGGTTCGTGAGTTGCGAGAGGAGCCCCAGGAGG
CGTTCCCTGGCAACGGCAAGCAGAAGGCCCAGGACGCGGAGATAGCGCGACTGCGCAAGGAGGTTGCCAAGCTCAAGATG
GAGCGCGACATCCTGAAAAAAGCCGCGGCCTACTTCGCGAAGGAGTCGATGTGA

Protein sequence :
MERRRTFSREFKLEAVRLVTERGVAVAQAAKDLDVHENVLRKWVRELREEPQEAFPGNGKQKAQDAEIARLRKEVAKLKM
ERDILKKAAAYFAKESM

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAF09029.1 unknown Not tested SHI-O Protein 5e-12 42
tnpJ AAD44752.1 TnpJ Not tested SHI-2 Protein 5e-12 42
unnamed AAQ07469.1 TnpJ-like protein Not tested Not named Protein 5e-12 42
c3576 NP_755451.1 hypothetical protein Not tested PAI I CFT073 Protein 7e-12 42
hp2 AAC61714.1 Hp2 Not tested PAI I CFT073 Protein 5e-12 42
unnamed AAF09021.1 unknown Not tested SHI-O Protein 5e-12 42
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-13 42
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-13 42
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-13 42
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-13 42
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-13 42
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-13 42
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-13 42
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-13 42
EXB21 ABD94708.1 putative transposase Not tested ExoU island B Protein 6e-08 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alide2_1830 YP_004387729.1 transposase IS3/IS911 family protein VFG1707 Protein 2e-12 42
Alide2_1830 YP_004387729.1 transposase IS3/IS911 family protein VFG1123 Protein 4e-14 42